Advanced Search (OLGA)

Gene: Nap1l5 (nucleosome assembly protein 1-like 5) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Nap1l5

Name:

nucleosome assembly protein 1-like 5

RGD ID:

1584123

Description:

Predicted to be involved in nucleosome assembly. Predicted to be located in nucleus. Orthologous to human NAP1L5 (nucleosome assembly protein 1 like 5); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC105733; similar to nucleosome assembly protein 1-like 5

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	89,352,834 - 89,354,704 (-)	NCBI		GRCr8
mRatBN7.2	4	88,022,670 - 88,024,988 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	88,022,569 - 88,024,654 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	93,238,048 - 93,239,915 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	89,013,364 - 89,015,231 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	87,382,414 - 87,384,281 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	89,149,314 - 89,152,511 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	89,149,317 - 89,151,184 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	153,970,370 - 153,972,262 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	87,796,429 - 87,798,296 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	82,782,974 - 82,784,841 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nap1l5	Rat	autosomal dominant polycystic kidney disease		ISO	RGD:1348887	8554872	ClinVar Annotator: match by term: Autosomal dominant polycystic kidney disease	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nap1l5	Rat	Experimental Liver Cirrhosis		ISO	RGD:1348887	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nap1l5	Rat	1,1-dichloroethene	decreases expression	ISO	RGD:1615911	6480464	vinylidene chloride results in decreased expression of NAP1L5 mRNA	CTD	PMID:26682919
Nap1l5	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:1615911	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Nap1l5	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1615911	6480464	ethylene dichloride results in decreased expression of NAP1L5 mRNA	CTD	PMID:28960355
Nap1l5	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of NAP1L5 mRNA	CTD	PMID:25380136
Nap1l5	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1615911	6480464	Ethinyl Estradiol results in increased expression of NAP1L5 mRNA	CTD	PMID:17942748
Nap1l5	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1615911	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NAP1L5 mRNA	CTD	PMID:17942748
Nap1l5	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:1615911	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Nap1l5	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:1615911	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Nap1l5	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1615911	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NAP1L5 mRNA	CTD	PMID:17942748
Nap1l5	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of NAP1L5 mRNA	CTD	PMID:32109520\|PMID:33387578\|PMID:34747641
Nap1l5	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1615911	6480464	Tetrachlorodibenzodioxin affects the expression of NAP1L5 mRNA	CTD	PMID:24680724
Nap1l5	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in decreased expression of NAP1L5 mRNA	CTD	PMID:32109520
Nap1l5	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:1615911	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Nap1l5	Rat	2-hydroxypropanoic acid	increases expression	ISO	RGD:1348887	6480464	Lactic Acid results in increased expression of NAP1L5 mRNA	CTD	PMID:30851411
Nap1l5	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1348887	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Nap1l5	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1348887	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Nap1l5	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:1615911	6480464	bisphenol S affects the methylation of NAP1L5 gene	CTD	PMID:31683443
Nap1l5	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1615911	6480464	bisphenol S results in increased expression of NAP1L5 mRNA	CTD	PMID:30951980
Nap1l5	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1615911	6480464	Fenretinide results in increased expression of NAP1L5 mRNA	CTD	PMID:28973697
Nap1l5	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of NAP1L5 mRNA	CTD	PMID:30047161
Nap1l5	Rat	aflatoxin B1	affects expression	ISO	RGD:1348887	6480464	Aflatoxin B1 affects the expression of NAP1L5 protein	CTD	PMID:20106945
Nap1l5	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1348887	6480464	Tretinoin results in increased expression of NAP1L5 mRNA	CTD	PMID:23724009
Nap1l5	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of NAP1L5 mRNA	CTD	PMID:30047161
Nap1l5	Rat	antirheumatic drug	increases expression	ISO	RGD:1348887	6480464	Antirheumatic Agents results in increased expression of NAP1L5 mRNA	CTD	PMID:24449571
Nap1l5	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1348887	6480464	Benzo(a)pyrene affects the methylation of NAP1L5 exon	CTD	PMID:27901495
Nap1l5	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1348887	6480464	Benzo(a)pyrene results in increased methylation of NAP1L5 promoter	CTD	PMID:27901495
Nap1l5	Rat	bis(2-ethylhexyl) phthalate	decreases methylation	ISO	RGD:1615911	6480464	Diethylhexyl Phthalate results in decreased methylation of NAP1L5 gene	CTD	PMID:38833407
Nap1l5	Rat	bis(2-ethylhexyl) phthalate	increases methylation	ISO	RGD:1615911	6480464	Diethylhexyl Phthalate results in increased methylation of NAP1L5 gene	CTD	PMID:34319233
Nap1l5	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NAP1L5 mRNA	CTD	PMID:25181051
Nap1l5	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of NAP1L5 gene	CTD	PMID:28505145
Nap1l5	Rat	calcitriol	decreases expression	ISO	RGD:1348887	6480464	Calcitriol results in decreased expression of NAP1L5 mRNA	CTD	PMID:21592394
Nap1l5	Rat	calcitriol	multiple interactions	ISO	RGD:1348887	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of NAP1L5 mRNA	CTD	PMID:21592394
Nap1l5	Rat	camptothecin	increases expression	ISO	RGD:1348887	6480464	Camptothecin results in increased expression of NAP1L5 mRNA	CTD	PMID:38460933
Nap1l5	Rat	chlordecone	increases expression	ISO	RGD:1615911	6480464	Chlordecone results in increased expression of NAP1L5 mRNA	CTD	PMID:33711761
Nap1l5	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1348887	6480464	Copper Sulfate results in decreased expression of NAP1L5 mRNA	CTD	PMID:19549813
Nap1l5	Rat	CU-O LINKAGE	increases expression	ISO	RGD:1348887	6480464	cupric oxide results in increased expression of NAP1L5 mRNA	CTD	PMID:22077320
Nap1l5	Rat	cyclosporin A	decreases expression	ISO	RGD:1348887	6480464	Cyclosporine results in decreased expression of NAP1L5 mRNA	CTD	PMID:20106945\|PMID:25562108\|PMID:27989131
Nap1l5	Rat	dexamethasone	multiple interactions	ISO	RGD:1348887	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Nap1l5	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1348887	6480464	di-n-butylphosphoric acid affects the expression of NAP1L5 mRNA	CTD	PMID:37042841
Nap1l5	Rat	dorsomorphin	multiple interactions	ISO	RGD:1348887	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Nap1l5	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of NAP1L5 mRNA	CTD	PMID:29391264
Nap1l5	Rat	ethanol	increases expression	ISO	RGD:1615911	6480464	Ethanol results in increased expression of NAP1L5 mRNA	CTD	PMID:30319688
Nap1l5	Rat	folic acid	decreases expression	ISO	RGD:1348887	6480464	Folic Acid results in decreased expression of NAP1L5 mRNA	CTD	PMID:21867686
Nap1l5	Rat	formaldehyde	decreases expression	ISO	RGD:1348887	6480464	Formaldehyde results in decreased expression of NAP1L5 mRNA	CTD	PMID:27664576
Nap1l5	Rat	indinavir	multiple interactions	ISO	RGD:1615911	6480464	[Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of NAP1L5 mRNA	CTD	PMID:16931933
Nap1l5	Rat	indometacin	multiple interactions	ISO	RGD:1348887	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Nap1l5	Rat	lamivudine	multiple interactions	ISO	RGD:1615911	6480464	[Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of NAP1L5 mRNA; [Zidovudine more ...	CTD	PMID:16931933
Nap1l5	Rat	lead(0)	affects expression	ISO	RGD:1348887	6480464	Lead affects the expression of NAP1L5 mRNA	CTD	PMID:28903495
Nap1l5	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of NAP1L5 mRNA	CTD	PMID:30047161
Nap1l5	Rat	methylmercury chloride	decreases expression	ISO	RGD:1348887	6480464	methylmercuric chloride results in decreased expression of NAP1L5 mRNA	CTD	PMID:28001369
Nap1l5	Rat	ozone	multiple interactions	ISO	RGD:1615911	6480464	[Air Pollutants results in increased abundance of Ozone] which results in decreased expression of NAP1L5 more ...	CTD	PMID:27106289
Nap1l5	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	RGD:1348887	6480464	p-Chloromercuribenzoic Acid results in decreased expression of NAP1L5 mRNA	CTD	PMID:26272509
Nap1l5	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	RGD:1348887	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Nap1l5	Rat	paracetamol	affects expression	ISO	RGD:1615911	6480464	Acetaminophen affects the expression of NAP1L5 mRNA	CTD	PMID:17562736
Nap1l5	Rat	PCB138	multiple interactions	ISO	RGD:1615911	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Nap1l5	Rat	quercetin	decreases expression	ISO	RGD:1348887	6480464	Quercetin results in decreased expression of NAP1L5 mRNA	CTD	PMID:21632981
Nap1l5	Rat	quinolin-8-ol	decreases expression	ISO	RGD:1348887	6480464	Oxyquinoline results in decreased expression of NAP1L5 mRNA	CTD	PMID:21632981
Nap1l5	Rat	rac-lactic acid	increases expression	ISO	RGD:1348887	6480464	Lactic Acid results in increased expression of NAP1L5 mRNA	CTD	PMID:30851411
Nap1l5	Rat	rifampicin	increases expression	ISO	RGD:1348887	6480464	Rifampin results in increased expression of NAP1L5 mRNA	CTD	PMID:24552687
Nap1l5	Rat	saquinavir	multiple interactions	ISO	RGD:1615911	6480464	[Zidovudine co-treated with Lamivudine co-treated with Saquinavir] results in increased expression of NAP1L5 mRNA	CTD	PMID:16931933
Nap1l5	Rat	SB 431542	multiple interactions	ISO	RGD:1348887	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Nap1l5	Rat	sodium arsenite	increases expression	ISO	RGD:1348887	6480464	sodium arsenite results in increased expression of NAP1L5 mRNA	CTD	PMID:28595984
Nap1l5	Rat	sodium arsenite	affects expression	ISO	RGD:1348887	6480464	sodium arsenite affects the expression of NAP1L5 mRNA	CTD	PMID:29319823
Nap1l5	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of NAP1L5 mRNA	CTD	PMID:30047161
Nap1l5	Rat	sunitinib	decreases expression	ISO	RGD:1348887	6480464	Sunitinib results in decreased expression of NAP1L5 mRNA	CTD	PMID:31533062
Nap1l5	Rat	temozolomide	decreases expression	ISO	RGD:1348887	6480464	Temozolomide results in decreased expression of NAP1L5 mRNA	CTD	PMID:31758290
Nap1l5	Rat	testosterone	multiple interactions	ISO	RGD:1348887	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of NAP1L5 mRNA	CTD	PMID:21592394
Nap1l5	Rat	testosterone	decreases expression	ISO	RGD:1348887	6480464	Testosterone results in decreased expression of NAP1L5 mRNA	CTD	PMID:21592394
Nap1l5	Rat	tetrachloromethane	affects expression	ISO	RGD:1615911	6480464	Carbon Tetrachloride affects the expression of NAP1L5 mRNA	CTD	PMID:17484886
Nap1l5	Rat	trichostatin A	increases expression	ISO	RGD:1348887	6480464	trichostatin A results in increased expression of NAP1L5 mRNA	CTD	PMID:24935251\|PMID:26272509
Nap1l5	Rat	trichostatin A	multiple interactions	ISO	RGD:1348887	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Nap1l5	Rat	urethane	decreases expression	ISO	RGD:1348887	6480464	Urethane results in decreased expression of NAP1L5 mRNA	CTD	PMID:28818685
Nap1l5	Rat	valproic acid	increases methylation	ISO	RGD:1348887	6480464	Valproic Acid results in increased methylation of NAP1L5 gene	CTD	PMID:29154799
Nap1l5	Rat	valproic acid	increases expression	ISO	RGD:1348887	6480464	Valproic Acid results in increased expression of NAP1L5 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:25192806\|PMID:26272509\|PMID:27188386\|PMID:28001369\|PMID:29154799
Nap1l5	Rat	valproic acid	multiple interactions	ISO	RGD:1348887	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Nap1l5	Rat	valproic acid	affects expression	ISO	RGD:1348887	6480464	Valproic Acid affects the expression of NAP1L5 mRNA	CTD	PMID:25979313
Nap1l5	Rat	valproic acid	affects expression	ISO	RGD:1615911	6480464	Valproic Acid affects the expression of NAP1L5 mRNA	CTD	PMID:17292431
Nap1l5	Rat	vancomycin	increases expression	ISO	RGD:1615911	6480464	Vancomycin results in increased expression of NAP1L5 mRNA	CTD	PMID:18930951
Nap1l5	Rat	vorinostat	multiple interactions	ISO	RGD:1348887	6480464	[NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Nap1l5	Rat	zidovudine	multiple interactions	ISO	RGD:1615911	6480464	[Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of NAP1L5 mRNA; [Zidovudine more ...	CTD	PMID:16931933

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nap1l5	Rat	nucleosome assembly	involved_in	IEA	InterPro:IPR002164	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nap1l5	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Nap1l5	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nap1l5	Rat	nucleus	located_in	IEA	InterPro:IPR002164	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nap1l5	Rat	protein binding	enables	ISO	RGD:1348887	1624291	UniProtKB:P08579\|UniProtKB:P18848\|UniProtKB:Q6PIF2\|UniProtKB:Q9ULW6 PMID:32296183	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:19103603	PMID:22871113

Nap1l5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	89,352,834 - 89,354,704 (-)	NCBI		GRCr8
mRatBN7.2	4	88,022,670 - 88,024,988 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	88,022,569 - 88,024,654 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	93,238,048 - 93,239,915 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	89,013,364 - 89,015,231 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	87,382,414 - 87,384,281 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	89,149,314 - 89,152,511 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	89,149,317 - 89,151,184 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	153,970,370 - 153,972,262 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	87,796,429 - 87,798,296 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	82,782,974 - 82,784,841 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

NAP1L5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	88,695,913 - 88,697,829 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	88,695,913 - 88,697,829 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	89,617,064 - 89,618,980 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	89,836,090 - 89,838,003 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	89,974,244 - 89,976,158	NCBI
Celera	4	86,913,019 - 86,914,976 (-)	NCBI		Celera
Cytogenetic Map	4	q22.1	NCBI
HuRef	4	85,368,983 - 85,370,940 (-)	NCBI		HuRef
CHM1_1	4	89,593,537 - 89,595,494 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	92,027,551 - 92,029,467 (-)	NCBI		T2T-CHM13v2.0

Nap1l5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	58,882,218 - 58,884,111 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	58,882,218 - 58,884,061 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	58,905,233 - 58,907,126 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	58,905,233 - 58,907,076 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	58,855,227 - 58,857,120 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	58,834,812 - 58,836,643 (-)	NCBI		MGSCv36	mm8
Celera	6	61,059,719 - 61,061,612 (-)	NCBI		Celera
Cytogenetic Map	6	B3	NCBI
cM Map	6	27.9	NCBI

Nap1l5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955474	11,743,565 - 11,745,311 (+)	NCBI	ChiLan1.0	ChiLan1.0

NAP1L5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	86,699,504 - 86,703,281 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	86,962,015 - 86,964,606 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	80,985,470 - 80,987,440 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	91,707,801 - 91,710,114 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

NAP1L5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	11,956,795 - 11,958,754 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	11,958,122 - 11,958,658 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	29,996,042 - 29,998,003 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	12,010,215 - 12,012,176 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	12,011,542 - 12,012,078 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	12,097,441 - 12,099,402 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	11,917,918 - 11,919,884 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	27,996,984 - 27,998,948 (+)	NCBI		UU_Cfam_GSD_1.0

Nap1l5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	29,412,191 - 29,414,196 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936685	1,142,826 - 1,143,401 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936685	1,142,051 - 1,143,536 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NAP1L5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	130,364,566 - 130,365,464 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	130,364,566 - 130,365,464 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	139,774,316 - 139,775,215 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NAP1L5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	37,055,286 - 37,057,649 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	37,056,569 - 37,057,117 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	15,807,485 - 15,809,793 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nap1l5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	16,372,499 - 16,372,994 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624757	16,371,276 - 16,373,098 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Nap1l5
10 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	514
Count of miRNA genes:	249
Interacting mature miRNAs:	316
Transcripts:	ENSRNOT00000010263
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	80212111	119233320	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	71647492	116647492	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	80216705	104243248	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	88883695	133883695	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	88883695	133883695	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
2306794	Ean2	Experimental allergic neuritis QTL 2	6.4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	4	82790777	97183061	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	86058928	131411333	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	61041057	94638356	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58079875	92690793	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	86583980	131583980	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat

RH143693

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	88,024,696 - 88,024,880 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	89,151,341 - 89,151,524	NCBI	Rnor6.0
Rnor_5.0	4	153,972,397 - 153,972,580	UniSTS	Rnor5.0
RGSC_v3.4	4	87,798,453 - 87,798,636	UniSTS	RGSC3.4
Celera	4	82,784,998 - 82,785,181	UniSTS
RH 3.4 Map	4	545.7	UniSTS
Cytogenetic Map	4	q24	UniSTS

RH139460

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	88,022,946 - 88,023,126 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	89,149,591 - 89,149,770	NCBI	Rnor6.0
Rnor_5.0	4	153,970,647 - 153,970,826	UniSTS	Rnor5.0
RGSC_v3.4	4	87,796,703 - 87,796,882	UniSTS	RGSC3.4
Celera	4	82,783,248 - 82,783,427	UniSTS
RH 3.4 Map	4	545.5	UniSTS
Cytogenetic Map	4	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	49	113	91	90	59	25	59	6	215	96	93	43	58	31


RefSeq Transcripts	NM_001044293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006236587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC087702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212518	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010263 ⟹ ENSRNOP00000010263

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	88,022,569 - 88,024,654 (-)	Ensembl
Rnor_6.0 Ensembl	4	89,149,317 - 89,151,184 (-)	Ensembl

RefSeq Acc Id:

NM_001044293 ⟹ NP_001037758

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	89,352,837 - 89,354,704 (-)	NCBI
mRatBN7.2	4	88,022,673 - 88,024,540 (-)	NCBI
Rnor_6.0	4	89,149,317 - 89,151,184 (-)	NCBI
Rnor_5.0	4	153,970,370 - 153,972,262 (-)	NCBI
RGSC_v3.4	4	87,796,429 - 87,798,296 (-)	RGD
Celera	4	82,782,974 - 82,784,841 (-)	RGD

Sequence:

show sequence

CTCAGACTCACTCTGGACCAGCCGCAGTCACAGCTGCAGGACCTCTCTGGACCAGCTCAGTCGCAGACTGCGCAACCACCAGACCACTGCGGCAAACAAGCCCAGCTGAGCCAAGCAATAGCGATGGC
CGACCCCGAGAAGCAGGGACCCGCTGAGAGCCGCGCCGAGGACGAGGTAATGGAGGGCGCTCAGGGTGGCGAGGATGCAGCAACCGGTGACAGTGCCACTGCACCCGCGGCCGAGGAGCCCCAGGCCC
CCGCGGAGAATGCGCCCAAGCCCAAAAATGACTTTATCGAGAGCTTGCCCAATCCCGTCAAGTGCCGGGTTCTGGCGCTCAAAAAGCTGCAGAAGCGCTGCGATAAGATCGAGGCGAAATTTGACAAG
GAATTCCAGGCTCTGGAGAAGAAGTACAATGATATCTACAAGCCCCTACTCGCCAAGATCCAGGAACTCACCGGAGAGATGGAGGGCTGCGCGTGGACCCTGGAGGGAGAGGATGATGAAGACGACGA
GGAAGAAGAAGATGAGGAGGAGGAAGAAGAGGAGGCTGCAGCTGGCGCAACTGGGGGTCCCGACTCTGCCGAGAAGTGAGCACAGCAGCTGACAGACTTGAGACTGATGAAAGGTTGTCAGTTAGATG
GGAATTAAAGTGCGTCACACGTTGAAATCCATTCATCACACTACACCTTAACACCCAAGCTAAGACAGAACTCTTCTCAATGCTTAATTCTTCAGTTTCTTTACATTTCCCAGCGCAGAGGAAGAGGA
ACCCAAGAACGACGTCATCTTTAAGACTTTTGCTTTTGCAAACCTAGACATCAGCTTTACACTCCAGAGGAGACAAGGCATGGAGGAAGGCTGGACTGACAGCATTTACTGTTTATGTGGCTAGAAAA
ACTGCCATTTCAAGTTGTGAAAAATGTTTTGAATATTTGAATTTACAGAAAGAACACGGTTCCAAAAATAAGGGTGTATTCCATGTATAATATTGTCAACACGTGTTCATCTGTAATGGTCTCATGTT
ATCTGTTTTCTTGGTAGTGTTTGTTTACAAAATCGTAAAAATTACCCCAAATGTTTTAAGTATTAAATTCCCTTATAGCATTTTAGAAATATAATTTACTTGAAGAGATGTAGAATGTAGCAATTCTG
TAAAGCATGTGTATCCAGTGTTGCCTAGTTTGACTTTGTGAAGTCTTTTTGTCTTGTAGCTTTTAGCAAGTAGCTGTGAAAACCATCAGAACTCCTCAATGAAGCTAATGTTTGGAAAAAAGTATATA
CTTGAAGAACCAACCCAAGTGTGTATCCCCAACCCCAGCTCAGAAATAGGAAGGATTTAAGTTTGCTTGTATTAGCTGTGCCTTCATTATTTTGCTATGTAAATGTGACTTATTAAATGGTGCATAAT
CAAATTTTATTGCTTGAGGACAAAAATGGCATAAAGGGAAGACTTTTGGGAAAAGACATTTAATGTAAAGGCCTTTAGCTTCTTTGTGGGTTTTGAACTATCTGTGAATCAATGTTCTGTAAAGAAAC
ACAAACGTAAAGTTGTTTACCACTGTGGTGTTAACAAAACAGTATTTTCAAAAATAAAAAAAACTTGTTATTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

RefSeq Acc Id:

XM_006236587 ⟹ XP_006236649

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	89,352,834 - 89,354,689 (-)	NCBI
mRatBN7.2	4	88,022,670 - 88,024,988 (-)	NCBI
Rnor_6.0	4	89,149,314 - 89,152,511 (-)	NCBI
Rnor_5.0	4	153,970,370 - 153,972,262 (-)	NCBI

Sequence:

show sequence

TGGAATTCATGTGTGTAAAATTCTTGCAAGACCCAAACAGAGAAAAATGGACCTAAACAGTAAT
GAATGTATCCTCTAGGAACCACCGAAGAGATTTGTGCTCTGCTCTTTATTCCAGAAGCTCTAAGGAGGCAGGAAGGACCTGGAGCTCACACCCATCATGATCAGAAATTTAAAGTTAGACTAGACCAG
CTAACCAAGTAAATAAATAAAACAAAATAAATAAATAAGTCTGCGCAGACCATTTTGGGTTCTCTAATTCTGGCTTGAATGGGTAAAAAATAAAAGATCACTTCATTATCAGAAAACACGACTTTGAT
GTTTATGGTCTTTTCCAAATGCTCTCACAGACAAGCCACAAGCAGACTCAAAGAACAGATGGTTAACTGTGAAGTGTTTGGTGACAAATGGCTGCTGAAGCATCTGTGGGTCCCTAAGGAAGAGGAGG
ACCAAACACATGCTTTTCAAGATGTGTTAAAACGACCTTTTTCGCCCAGCCTTTATAGGCACGTCTAACCTGCTCTCAGGAAGAAATGAGCCTCTCAAAAAGAAGCTGAATTTGGCCCTACACATCTG
TACATGACAGCGTTTTTTCATAGTGTCACATGGTTGGACATTCCAAGGGCTTTGCCTTTTTTTCTATTTACCCTCGCTTTCTTTTCATAGGCACCTGTGTGGACTCTTCAGTGGGTAACATTACCAGA
GTACGCACAGCGTGGAAATTTGCCACGCAAACTCTTACAGAAGCAATTCCAAGGTCCCTCCCGACACAATTTGCCACTAGGATATATGTAACTAGGTTCAACAGAGATGTCTGACTGGCTGCTCTAGG
AACCCAAAATGGTCAGCGCAGATACACGCACTGCAGGTCTGCGAAAGAGAAGGAGGAAAATGGTTCTCCCACATTTCTGTTCTTTGGAAGTGAATTTAAGATGCATTCAAGATTTGGAAATGTACCCA
TGACCAAGGCTGACCAGCATCAGCTATGGTGCATTTCCGACAAGATTGGGCAGATGCATTGCGGATTTTGGAGAGCTGAGATGGGAGGGGGAGCACACAGTAAACAGATGGGGGCTGTATAAACAGGT
ATGGAAAAATACAGTCTCAGCCTCGATCTGGTTCCAGCCAGTTCTGCAGGGGTGGGGGCGGATGTTGAGGGCTGGGTGTCTAAGTGGCAGGCTTTAGAGACCTCGGAGATAGCAGCATAGCAACAATT
TGGTGCAGTGTGTGCGCACAGCCATCAGCTGATAGTGAGCAGCCATTCACTTGCCGCGAGCCGCGAAGCGGCCGCGCGGACGTCACCACAGCCGTCAGCGTTTGCCGCATCCTCAGACTCACTCTGGA
CCAGCCGCAGTCACAGCTGCAGGACCTCTCTGGACCAGCTCAGTCGCAGACTGCGCAACCACCAGACCACTGCGGCAAACAAGCCCAGCTGAGCCAAGCAATAGCGATGGCCGACCCCGAGAAGCAGG
GACCCGCTGAGAGCCGCGCCGAGGACGAGGTAATGGAGGGCGCTCAGGGTGGCGAGGATGCAGCAACCGGTGACAGTGCCACTGCACCCGCGGCCGAGGAGCCCCAGGCCCCCGCGGAGAATGCGCCC
AAGCCCAAAAATGACTTTATCGAGAGCTTGCCCAATCCCGTCAAGTGCCGGGTTCTGGCGCTCAAAAAGCTGCAGAAGCGCTGCGATAAGATCGAGGCGAAATTTGACAAGGAATTCCAGGCTCTGGA
GAAGAAGTACAATGATATCTACAAGCCCCTACTCGCCAAGATCCAGGAACTCACCGGAGAGATGGAGGGCTGCGCGTGGACCCTGGAGGGAGAGGATGATGAAGACGACGAGGAAGAAGAAGATGAGG
AGGAGGAAGAAGAGGAGGCTGCAGCTGGCGCAACTGGGGGTCCCGACTCTGCCGAGAAGTGAGCACAGCAGCTGACAGCGCAGAGGAAGAGGAACCCAAGAACGACGTCATCTTTAAGACTTTTGCTT
TTGCAAACCCAGACATCAGCTTTACACTCCAGAGGAGACAAGGCATGGAGGAAGGCTGGACTGACAGCATTTACTGTTTATGTGGCTAGAAAAACTGCCATTTCAAGTTGTGAAAAATGTTTTGAATA
TTTGAATTTACAGAAAGAACACGGTTCCAAAAATAAGGGTGTATTCCATGTATAATATTGTCAACACGTGTTCATCTGTAATGGTCTCATGTTATCTGTTTTCTTGGTAGTGTTTGTTTACAAAATCG
TAAAAATTACCCCAAATGTTTTAAGTATTAAATTCCCTTATAGCATTTTAGAAATATAATTTACTTGAAGAGATGTAGAATGTAGCAATTCTGTAAAGCATGTGTATCCAGTGTTGCCTAGTTTGACT
TTGTGAAGTCTTTTTGTCTTGTAGCTTTTAGCAAGTAGCTGTGAAAACCATCAGAACTCCTCAATGAAGCTAATGTTTGGAAAAAAGTATATACTTGAAGAACCAACCCAAGTGTGTATCCCCAACCC
CAGCTCAGAAATAGGAAGGATTTAAGTTTGCTTGTATTAGCTGTGCCTTCATTATTTTGCTATGTAAATGTGACTTATTAAATGGTGCATAATCAAATTTTATTGCTTGAGGACAAAAATGGCATAAA
GGGAAGACTTTTGGGAAAAGACATTTAATGTAAAGGCCTTTAGCTTCTTTGTGGGTTTTGAACTATCTGTGAATCAATGTTCTGTAAAGAAACACAAACGTAAAGTTGTTTACCACTGTGGTGTTAAC
AAAACAGTATTTTCAAAAATAAAAAAAACTTGTTATTCTGA

hide sequence


Protein RefSeqs	NP_001037758	(Get FASTA)	NCBI Sequence Viewer
	XP_006236649	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87702	(Get FASTA)	NCBI Sequence Viewer
	EDL88029	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010263.2
	ENSRNOP00000099012
GenBank Protein	Q5PPG6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001037758 ⟸ NM_001044293
- UniProtKB:	Q5PPG6 (UniProtKB/Swiss-Prot), A6K144 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADPEKQGPAESRAEDEVMEGAQGGEDAATGDSATAPAAEEPQAPAENAPKPKNDFIESLPNPVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEDDED DEEEEDEEEEEEEAAAGATGGPDSAEK hide sequence

RefSeq Acc Id:	XP_006236649 ⟸ XM_006236587
- Peptide Label:	isoform X1
- UniProtKB:	Q5PPG6 (UniProtKB/Swiss-Prot), A6K144 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADPEKQGPAESRAEDEVMEGAQGGEDAATGDSATAPAAEEPQAPAENAPKPKNDFIESLPNPV KCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEDDEDDEEEEDEEEEEEEAAAGATGGPDSAEK hide sequence

Ensembl Acc Id:

ENSRNOP00000010263 ⟸ ENSRNOT00000010263

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5PPG6-F1-model_v2	AlphaFold	Q5PPG6	1-155	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693089

Promoter ID:

EPDNEW_R3614

Type:

initiation region

Name:

Nap1l5_1

Description:

nucleosome assembly protein 1-like 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	89,151,175 - 89,151,235	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-44653	BioCyc
Ensembl Genes	ENSRNOG00000007808	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000083613	ENTREZGENE
Ensembl Transcript	ENSRNOT00000010263.4	UniProtKB/Swiss-Prot
	ENSRNOT00000122186	ENTREZGENE
Gene3D-CATH	1.20.5.1500	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7313964	IMAGE-MGC_LOAD
InterPro	NAP-like_sf	UniProtKB/Swiss-Prot
	NAP_family	UniProtKB/Swiss-Prot
KEGG Report	rno:688843	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105733	IMAGE-MGC_LOAD
NCBI Gene	688843	ENTREZGENE
PANTHER	PTHR11875	UniProtKB/Swiss-Prot
Pfam	NAP	UniProtKB/Swiss-Prot
PhenoGen	Nap1l5	PhenoGen
RatGTEx	ENSRNOG00000007808	RatGTEx
	ENSRNOG00000083613	RatGTEx
Superfamily-SCOP	SSF143113	UniProtKB/Swiss-Prot
UniProt	A6K144	ENTREZGENE, UniProtKB/TrEMBL
	NP1L5_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Nap1l5	nucleosome assembly protein 1-like 5	MGC105733	similar to nucleosome assembly protein 1-like 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	MGC105733	similar to nucleosome assembly protein 1-like 5	LOC682844	similar to nucleosome assembly protein 1-like 5	Data merged from RGD:1594004	1643240	APPROVED
2006-11-20	LOC682844	similar to nucleosome assembly protein 1-like 5			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	MGC105733	similar to nucleosome assembly protein 1-like 5			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD