Advanced Search (OLGA)

Gene: Calml4 (calmodulin-like 4) Rattus norvegicus

Analyze

Symbol:

Calml4

Name:

calmodulin-like 4

RGD ID:

1583918

Description:

Predicted to enable calcium ion binding activity; enzyme regulator activity; and myosin head/neck binding activity. Predicted to be involved in brush border assembly and microtubule cytoskeleton organization. Predicted to be located in microvillus. Predicted to be active in cytoplasm. Orthologous to human CALML4 (calmodulin like 4); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calmodulin-like protein 4; LOC691455; similar to calmodulin-like 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CALML4 (calmodulin like 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Calml4 (calmodulin-like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Calml4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Calml4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Calml4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Calml4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CALML4 (calmodulin like 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Calml4 (calmodulin-like 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	calml4a (calmodulin-like 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	calml4a (calmodulin-like 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	calml4b (calmodulin-like 4b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG17272	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG17272	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T09B4.4	Alliance	DIOPT (OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T09B4.4	Alliance	DIOPT (PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	cal-1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	cal-3	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	pat-10	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	calml4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	calml4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	72,218,870 - 72,230,650 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	72,218,613 - 72,230,650 (+)	Ensembl				GRCr8
mRatBN7.2	8	63,323,426 - 63,335,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	63,323,351 - 63,335,234 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	68,838,506 - 68,850,149 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	67,110,960 - 67,122,603 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	64,980,956 - 64,992,609 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	67,753,279 - 67,765,359 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	67,753,279 - 67,765,358 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	67,007,122 - 67,018,886 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	62,738,382 - 62,750,146 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP,ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

atrazine (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (EXP)

diiodine (ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP,ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glycidol (EXP)

glyphosate (EXP)

indometacin (ISO)

L-methionine (ISO)

lead(0) (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N(4)-hydroxycytidine (ISO)

N-nitrosodiethylamine (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pyrogallol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

tributylstannane (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brush border assembly (IEA,ISO)

microtubule cytoskeleton organization (IBA)

Cellular Component

cytoplasm (IBA)

microvillus (IEA,ISO)

Molecular Function

calcium ion binding (IBA,IEA)

enzyme regulator activity (IBA)

myosin head/neck binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Calml4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	72,218,870 - 72,230,650 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	72,218,613 - 72,230,650 (+)	Ensembl				GRCr8
mRatBN7.2	8	63,323,426 - 63,335,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	63,323,351 - 63,335,234 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	68,838,506 - 68,850,149 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	67,110,960 - 67,122,603 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	64,980,956 - 64,992,609 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	67,753,279 - 67,765,359 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	67,753,279 - 67,765,358 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	67,007,122 - 67,018,886 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	62,738,382 - 62,750,146 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

CALML4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	68,190,705 - 68,206,110 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	68,190,705 - 68,206,087 (-)	Ensembl			hg38	GRCh38
GRCh37	15	68,483,043 - 68,498,448 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	66,270,097 - 66,285,502 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	66,270,479 - 66,285,502	NCBI
Celera	15	45,367,956 - 45,383,362 (-)	NCBI		Celera
Cytogenetic Map	15	q23	NCBI
HuRef	15	45,313,778 - 45,329,162 (-)	NCBI		HuRef
CHM1_1	15	68,600,995 - 68,616,402 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	66,009,455 - 66,024,859 (-)	NCBI		T2T-CHM13v2.0

Calml4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	62,765,068 - 62,783,203 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	62,765,362 - 62,783,203 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	62,857,472 - 62,875,921 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	62,858,080 - 62,875,921 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	62,705,911 - 62,723,725 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	62,656,110 - 62,673,924 (+)	NCBI		MGSCv36	mm8
Celera	9	60,083,497 - 60,094,995 (+)	NCBI		Celera
Cytogenetic Map	9	B	NCBI
cM Map	9	33.9	NCBI

Calml4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	7,887,414 - 7,894,143 (+)	Ensembl
ChiLan1.0	NW_004955450	7,886,565 - 7,894,143 (+)	NCBI	ChiLan1.0	ChiLan1.0

CALML4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	57,444,352 - 57,460,549 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	61,618,194 - 61,634,392 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	47,140,272 - 47,155,700 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	65,409,732 - 65,424,852 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	65,409,732 - 65,424,852 (-)	Ensembl			panPan2	panpan1.1

CALML4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	32,234,879 - 32,244,321 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	32,235,091 - 32,240,008 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	32,169,539 - 32,179,258 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	32,430,743 - 32,440,471 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	32,430,780 - 32,435,698 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	32,359,011 - 32,368,754 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	32,420,957 - 32,430,694 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	32,666,809 - 32,676,532 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Calml4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	110,210,102 - 110,222,226 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	28,058,176 - 28,067,442 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	28,058,165 - 28,067,463 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CALML4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	166,083,629 - 166,099,593 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	166,089,583 - 166,099,794 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CALML4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	15,278,349 - 15,291,934 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	126,176,796 - 126,188,708 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Calml4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	4,882,136 - 4,888,358 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624781	4,880,142 - 4,892,829 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Calml4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	57,153,140 - 57,164,943 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Calml4
34 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	147
Count of miRNA genes:	113
Interacting mature miRNAs:	125
Transcripts:	ENSRNOT00000009716
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	58991697	91341052	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	58991697	91341052	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	58991697	91341052	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat

Markers in Region

RH141552

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	63,334,888 - 63,335,079 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	67,765,013 - 67,765,203	NCBI	Rnor6.0
Rnor_5.0	8	67,493,760 - 67,493,950	UniSTS	Rnor5.0
RGSC_v3.4	8	67,018,541 - 67,018,731	UniSTS	RGSC3.4
Celera	8	62,749,801 - 62,749,991	UniSTS
RH 3.4 Map	8	792.2	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	156	91	90	59	82	59	6	346	182	11	132	81	92	31	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001127575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006243243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009716 ⟹ ENSRNOP00000009716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	72,218,613 - 72,230,650 (+)	Ensembl
mRatBN7.2 Ensembl	8	63,323,351 - 63,335,234 (+)	Ensembl
Rnor_6.0 Ensembl	8	67,753,279 - 67,765,358 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106596 ⟹ ENSRNOP00000079478

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	63,323,461 - 63,334,789 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109828 ⟹ ENSRNOP00000083397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	72,218,886 - 72,230,650 (+)	Ensembl
mRatBN7.2 Ensembl	8	63,323,469 - 63,335,234 (+)	Ensembl

RefSeq Acc Id:

NM_001127575 ⟹ NP_001121047

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	72,218,886 - 72,230,650 (+)	NCBI
mRatBN7.2	8	63,323,469 - 63,335,234 (+)	NCBI
Rnor_6.0	8	67,753,279 - 67,765,358 (+)	NCBI
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI
RGSC_v3.4	8	67,007,122 - 67,018,886 (+)	RGD
Celera	8	62,738,382 - 62,750,146 (+)	RGD

Sequence:

show sequence

ATTTATTACCAGGCCTCCACCCAGCCTGGTGGACTTTCGACTCCAAGCCGGAGTAAAGAGAACC
AAACACAGTTCCAGGAGCCAGGGGTGCCTGAGGATGGCCAAGTTCCTTTCCCAGGAGCAAATTA
ATGAGTACAAGGAATGCTTCTCCCTGTATGACAAGCAGCAAAGAGGGAAGATTAAGGCCACAGA
TCTCCTGGTGTCCATGAGGTGCCTGGGGGCCAGCCCCACACCTGGGGAAGTGCAGCGGCACCTG
CAGACTCATGGAATAGACAAGAACGGAGAACTGGATTTCTCCACCTTCCTGACCATTATGCACA
TGCAAATCAAGCAAGAGGACCCAAAGAAAGAAATCCTTCTGGCCATGCTGATGACAGACAAGGA
GAAGAAAGGTTACATCATGGCGTCTGAGTTGCGGTCGAAACTCATGAAACTGGGAGAGAAGCTC
ACTCACAAAGAAGTGGATGAGCTTTTCAAGGAAGCGGGCATCGAACCTAACGGCCAAGTGAAAT
ATGACACGTTTATCCAGAGGATCACCCTGCCCGTGCGAGACTACTAGGGAGCCGAGGTCAAGGG
AGCAGAGGATGACAGCCTCCGGGGCCTGAAAACCTGGACTGAAGGTTTTTGTAAGGGAAGTCTA
GAGATGGCGAACACAGCAGTAAGACCACATGGCACAACCCCTGCAGGGGGTGAATACCAATAAA
TGATGTGGCCATGTACTGGTTGCCTGTAAGAGGAGGTCTGTCTGGATTTCCGTACTAACATTAC
CCAGCCCTTTGCAGCATGGACGGGCTGCCTCTGCAACGTCATCCCCCTCACCCACTGTACTTCT
CAAAGCCTTTGGACCTCACAAAGATGACGATGATGACTTGAAAATAAATGCGTGGCAACTCAAG

hide sequence

RefSeq Acc Id:

XM_006243243 ⟹ XP_006243305

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	72,218,870 - 72,230,649 (+)	NCBI
mRatBN7.2	8	63,323,451 - 63,335,233 (+)	NCBI
Rnor_6.0	8	67,753,298 - 67,765,359 (+)	NCBI
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI

Sequence:

show sequence

CCCAGCCTGGTGGACTTTCGACTCCAAGCCGGAGTAAAGAGAACCAAACACAGTTCCAGGAGCC
AGGGGTGCCTGAGGATGAGTACAAGGAATGCTTCTCCCTGTATGACAAGCAGCAAAGAGGGAAG
ATTAAGGCCACAGATCTCCTGGTGTCCATGAGGTGCCTGGGGGCCAGCCCCACACCTGGGGAAG
TGCAGCGGCACCTGCAGACTCATGGAATAGACAAGAACGGAGAACTGGATTTCTCCACCTTCCT
GACCATTATGCACATGCAAATCAAGCAAGAGGACCCAAAGAAAGAAATCCTTCTGGCCATGCTG
ATGACAGACAAGGAGAAGAAAGGTTACATCATGGCGTCTGAGTTGCGGTCGAAACTCATGAAAC
TGGGAGAGAAGCTCACTCACAAAGAAGTGGATGAGCTTTTCAAGGAAGCGGGCATCGAACCTAA
CGGCCAAGTGAAATATGACACGTTTATCCAGAGGATCACCCTGCCCGTGCGAGACTACTAGGGA
GCCGAGGTCAAGGGAGCAGAGGATGACAGCCTCCGGGGCCTGAAAACCTGGACTGAAGGTTTTT
GTAAGGGAAGTCTAGAGATGGCGAACACAGCAGTAAGACCACATGGCACAACCCCTGCAGGGGG
TGAATACCAATAAATGATGTGGCCATGTACTGGTTGCCTGTAAGAGGAGGTCTGTCTGGATTTC
CGTACTAACATTACCCAGCCCTTTGCAGCATGGACGGGCTGCCTCTGCAACGTCATCCCCCTCA
CCCACTGTACTTCTCAAAGCCTTTGGACCTCACAAAGATGACGATGATGACTTGAAAATAAATG
CGTGGCAACTCAAGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001121047	(Get FASTA)	NCBI Sequence Viewer
	XP_006243305	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58760	(Get FASTA)	NCBI Sequence Viewer
	EDL95761	(Get FASTA)	NCBI Sequence Viewer
	EDL95762	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009716.6
	ENSRNOP00000083397.1

RefSeq Acc Id:	NP_001121047 ⟸ NM_001127575
- UniProtKB:	B0BNB8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAKFLSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGEL DFSTFLTIMHMQIKQEDPKKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHKEVDELFKE AGIEPNGQVKYDTFIQRITLPVRDY hide sequence

RefSeq Acc Id:	XP_006243305 ⟸ XM_006243243
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZX47 (UniProtKB/TrEMBL), A6J589 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRCLGASPTPGEVQRHLQTHGIDKNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMTDKEKKGY IMASELRSKLMKLGEKLTHKEVDELFKEAGIEPNGQVKYDTFIQRITLPVRDY hide sequence

Ensembl Acc Id:

ENSRNOP00000009716 ⟸ ENSRNOT00000009716

Ensembl Acc Id:

ENSRNOP00000083397 ⟸ ENSRNOT00000109828

Ensembl Acc Id:

ENSRNOP00000079478 ⟸ ENSRNOT00000106596

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BNB8-F1-model_v2	AlphaFold	B0BNB8	1-153	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696056

Promoter ID:

EPDNEW_R6581

Type:

initiation region

Name:

Calml4_1

Description:

calmodulin-like 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	67,753,309 - 67,753,369	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583918	AgrOrtholog
BioCyc Gene	G2FUF-30147	BioCyc
Ensembl Genes	ENSRNOG00000038202	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009716.7	UniProtKB/TrEMBL
	ENSRNOT00000109828.2	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7099908	IMAGE-MGC_LOAD
InterPro	Ca-Reg_Muscle_Contr_Cell_Proc	UniProtKB/TrEMBL
	EF-hand-like_dom	UniProtKB/TrEMBL
	EF_hand_Ca-bd	UniProtKB/TrEMBL
KEGG Report	rno:691455	UniProtKB/TrEMBL
MGC_CLONE	MGC:187971	IMAGE-MGC_LOAD
NCBI Gene	691455	ENTREZGENE
PANTHER	CALMODULIN LIKE 4	UniProtKB/TrEMBL
	MYOSIN LIGHT CHAIN 1, 3	UniProtKB/TrEMBL
Pfam	EF-hand_8	UniProtKB/TrEMBL
	EF_hand_5	UniProtKB/TrEMBL
PhenoGen	Calml4	PhenoGen
PROSITE	EF_HAND_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000038202	RatGTEx
SMART	EFh	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/TrEMBL
UniProt	A0A8I5ZX47	ENTREZGENE, UniProtKB/TrEMBL
	A6J589	ENTREZGENE, UniProtKB/TrEMBL
	B0BNB8	ENTREZGENE, UniProtKB/TrEMBL
	F7F9Q8_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Calml4	calmodulin-like 4	LOC691455	similar to calmodulin-like 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC691455	similar to calmodulin-like 4	LOC686783	similar to calmodulin-like 4	Data merged from RGD:1593679	1643240	APPROVED
2006-11-20	LOC686783	similar to calmodulin-like 4			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC691455	similar to calmodulin-like 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message