Abracl (ABRA C-terminal like) - Rat Genome Database

Name: Abracl
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Abracl (ABRA C-terminal like) Rattus norvegicus

Analyze

Symbol:

Abracl

Name:

ABRA C-terminal like

RGD ID:

1583256

Description:

Predicted to be involved in regulation of actin filament-based process. Orthologous to human ABRACL (ABRA C-terminal like); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

costars family protein ABRACL; hypothetical protein LOC685045; LOC685045; similar to Protein C6orf115; uncharacterized protein LOC685045

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ABRACL (ABRA C-terminal like)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Abracl (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Abracl (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ABRACL (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ABRACL (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Abracl (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ABRACL (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ABRACL (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Abracl (ABRA C-terminal like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ABRACL (ABRA C-terminal like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Abracl (ABRA C-terminal like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	abracl (ABRA C-terminal like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	abracl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	14,474,802 - 14,484,992 (-)	NCBI		GRCr8
mRatBN7.2	1	12,654,951 - 12,665,143 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	12,654,838 - 12,665,207 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	12,426,988 - 12,437,196 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	18,428,914 - 18,439,123 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	12,635,289 - 12,645,481 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	13,165,583 - 13,175,773 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	13,165,572 - 13,175,876 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	14,859,230 - 14,869,420 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	13,063,558 - 13,073,748 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	11,112,403 - 11,122,593 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Familial Behcet-Like Autoinflammatory Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenzo[a,l]pyrene (ISO)

Dibutyl phosphate (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

fulvestrant (ISO)

indometacin (ISO)

ivermectin (ISO)

ketoconazole (ISO)

methimazole (EXP)

paracetamol (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

testosterone (ISO)

tetrachloromethane (ISO)

thiram (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of actin filament-based process (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Abracl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	14,474,802 - 14,484,992 (-)	NCBI		GRCr8
mRatBN7.2	1	12,654,951 - 12,665,143 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	12,654,838 - 12,665,207 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	12,426,988 - 12,437,196 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	18,428,914 - 18,439,123 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	12,635,289 - 12,645,481 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	13,165,583 - 13,175,773 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	13,165,572 - 13,175,876 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	14,859,230 - 14,869,420 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	13,063,558 - 13,073,748 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	11,112,403 - 11,122,593 (-)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

ABRACL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	139,028,745 - 139,043,302 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	139,028,745 - 139,043,302 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	139,349,882 - 139,364,439 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	139,391,512 - 139,406,132 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	140,089,868 - 140,104,496 (+)	NCBI		Celera
Cytogenetic Map	6	q24.1	NCBI
HuRef	6	136,911,451 - 136,925,964 (+)	NCBI		HuRef
CHM1_1	6	139,612,858 - 139,627,484 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	140,215,028 - 140,231,830 (+)	NCBI		T2T-CHM13v2.0

Abracl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	17,887,008 - 17,899,000 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	17,887,008 - 17,899,036 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	18,011,260 - 18,023,252 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	18,011,260 - 18,023,288 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	17,731,066 - 17,743,058 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	17,700,677 - 17,728,665 (-)	NCBI		MGSCv36	mm8
Celera	10	17,909,262 - 17,921,258 (-)	NCBI		Celera
Cytogenetic Map	10	A3	NCBI
cM Map	10	7.39	NCBI

Abracl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	20,634,071 - 20,645,609 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	20,634,128 - 20,645,609 (-)	NCBI	ChiLan1.0	ChiLan1.0

ABRACL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	158,996,095 - 159,010,940 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	156,890,068 - 156,904,672 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	136,789,968 - 136,804,723 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	140,871,265 - 140,885,938 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	140,871,264 - 140,889,288 (+)	Ensembl	panpan1.1		panPan2

ABRACL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	31,254,959 - 31,267,167 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	31,254,551 - 31,275,981 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	32,128,027 - 32,140,741 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	31,415,757 - 31,428,486 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	31,416,541 - 31,428,489 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	31,291,698 - 31,304,485 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	31,173,987 - 31,186,660 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	31,485,157 - 31,498,022 (+)	NCBI		UU_Cfam_GSD_1.0

Abracl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	126,299,375 - 126,311,342 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	6,078,625 - 6,090,612 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936560	6,078,659 - 6,090,222 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ABRACL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	25,432,706 - 25,447,594 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	25,432,314 - 25,447,016 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	28,570,439 - 28,585,808 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ABRACL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	34,354,533 - 34,369,070 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	34,354,279 - 34,364,673 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	6,497,900 - 6,512,731 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Abracl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	14,922,862 - 14,935,567 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	14,923,097 - 14,935,432 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Abracl
116 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	27
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000016618
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat

Markers in Region

RH139648

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	12,655,303 - 12,655,503 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	13,165,936 - 13,166,135	NCBI	Rnor6.0
Rnor_5.0	1	14,859,583 - 14,859,782	UniSTS	Rnor5.0
RGSC_v3.4	1	13,063,911 - 13,064,110	UniSTS	RGSC3.4
Celera	1	11,112,756 - 11,112,955	UniSTS
RH 3.4 Map	1	129.81	UniSTS
Cytogenetic Map	1	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001099647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473994	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO569536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000084870 ⟹ ENSRNOP00000074648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	12,654,838 - 12,665,207 (-)	Ensembl
Rnor_6.0 Ensembl	1	13,165,572 - 13,175,876 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103174 ⟹ ENSRNOP00000095788

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	12,654,838 - 12,659,469 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107631 ⟹ ENSRNOP00000083184

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	12,654,952 - 12,664,166 (-)	Ensembl

RefSeq Acc Id:

NM_001099647 ⟹ NP_001093117

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	14,474,802 - 14,484,992 (-)	NCBI
mRatBN7.2	1	12,654,951 - 12,665,143 (-)	NCBI
Rnor_6.0	1	13,165,583 - 13,175,773 (-)	NCBI
Rnor_5.0	1	14,859,230 - 14,869,420 (-)	NCBI
RGSC_v3.4	1	13,063,558 - 13,073,748 (-)	RGD
Celera	1	11,112,403 - 11,122,593 (-)	RGD

Sequence:

show sequence

GGTTCAGACCCACGCGGCGAGCAGCTCTTCAGTGAAGAAGGAAGCAATCGGAGGGTCAGCAATG
AACGTGGAGCATGAGGTTAACCTCCTGGTGGAGGAAATTCATCGTCTGGGTTCCAAAAATGCCG
ATGGGAAACTGAGTGTGAAGTTTGGGGTCCTCTTCCAAGACGACAGATGTGCCAATCTCTTTGA
AGCGTTGGTGGGAACTCTGAAAGCCGCAAAACGAAGGAAGATTGTTACGTACGCAGGAGAGCTG
CTTTTGCAAGGTGTTCATGATGATGTTGACATTGTATTGCTGCAAGATTAATGTGGTTTGCAGA
TCTGGGGGTATCTGGTAAACTGGAATAATTAAGTTAAAGGACAAACATGAAGTTCCTTATGTAT
TTTTATAGACCTTTGTAAACAAAAGGGGACTTGTTGAGAAGTCCTGTTTTTATACCTTGGAGCA
AAACATTACAATGTAAAAATAAACAAAACCTGTTATTTTTTTTTTCTTAAGAAGGTAATCGGGA
GACGTAGGCAATAAAATGTTTTCAGAGGTGCGAAAAAGCTTTTGTTTTCTTAAACCATTCTTAG
TCTCTGCCACACTTGACACTCCGTCAAAGTGAGAAGCGAACTAAAGACCAACTGCGGTGGAAAA
TATTATGTTTATGTAATAAAAAAAAATCATGTAACTGCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001093117	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89921	(Get FASTA)	NCBI Sequence Viewer
	EDL93765	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074648.2
	ENSRNOP00000083184.1
	ENSRNOP00000095788.1

RefSeq Acc Id:	NP_001093117 ⟸ NM_001099647
- UniProtKB:	A6JP93 (UniProtKB/TrEMBL), A6JP92 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNVEHEVNLLVEEIHRLGSKNADGKLSVKFGVLFQDDRCANLFEALVGTLKAAKRRKIVTYAGE LLLQGVHDDVDIVLLQD hide sequence

Ensembl Acc Id:

ENSRNOP00000074648 ⟸ ENSRNOT00000084870

Ensembl Acc Id:

ENSRNOP00000095788 ⟸ ENSRNOT00000103174

Ensembl Acc Id:

ENSRNOP00000083184 ⟸ ENSRNOT00000107631

Protein Domains

Costars

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZSL2-F1-model_v2	AlphaFold	D3ZSL2	1-81	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689504

Promoter ID:

EPDNEW_R29

Type:

initiation region

Name:

Abracl_1

Description:

ABRA C-terminal like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	13,175,805 - 13,175,865	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583256	AgrOrtholog
BioCyc Gene	G2FUF-62280	BioCyc
Ensembl Genes	ENSRNOG00000051450	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000084870.2	UniProtKB/TrEMBL
	ENSRNOT00000103174.1	UniProtKB/TrEMBL
	ENSRNOT00000107631.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.1540	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7306744	IMAGE-MGC_LOAD
InterPro	Costars	UniProtKB/TrEMBL
	Costars_dom	UniProtKB/TrEMBL
	Costars_sf	UniProtKB/TrEMBL
KEGG Report	rno:685045	UniProtKB/TrEMBL
MGC_CLONE	MGC:109201	IMAGE-MGC_LOAD
NCBI Gene	685045	ENTREZGENE
PANTHER	COSTARS FAMILY PROTEIN ABRACL	UniProtKB/TrEMBL
	PTHR46334	UniProtKB/TrEMBL
Pfam	Costars	UniProtKB/TrEMBL
PhenoGen	Abracl	PhenoGen
RatGTEx	ENSRNOG00000051450	RatGTEx
SMART	Costars	UniProtKB/TrEMBL
UniProt	A0A8I6G8K6_RAT	UniProtKB/TrEMBL
	A6JP92	ENTREZGENE, UniProtKB/TrEMBL
	A6JP93	ENTREZGENE, UniProtKB/TrEMBL
	D3ZSL2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-09-26	Abracl	ABRA C-terminal like	LOC685045	similar to Protein C6orf115	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC685045	similar to Protein C6orf115			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar