Advanced Search (OLGA)

Gene: Prelid3a (PRELI domain containing 3A) Rattus norvegicus

Analyze

Symbol:

Prelid3a

Name:

PRELI domain containing 3A

RGD ID:

1582858

Description:

Predicted to enable phosphatidic acid transfer activity. Predicted to be involved in phospholipid transport. Predicted to be active in mitochondrial intermembrane space. Orthologous to human PRELID3A (PRELI domain containing 3A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; Brodifacoum.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC690253; PRELI domain containing protein 3A; similar to chromosome 18 open reading frame 43; Slmo1; slowmo homolog 1; slowmo homolog 1 (Drosophila)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRELID3A (PRELI domain containing 3A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Prelid3a (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prelid3a (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRELID3A (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRELID3A (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prelid3a (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRELID3A (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRELID3A (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prelid3a (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Prelid3a (PRELI domain containing 3A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PRELID3A (PRELI domain containing 3A)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Prelid3a (PRELI domain containing 3A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prelid3a (PRELI domain containing 3A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F15D3.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UPS2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UPS3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	UPS3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	slmo	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prelid3a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	prelid3a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	63,268,766 - 63,301,770 (+)	Ensembl				GRCr8
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	61,017,764 - 61,031,883 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	63,088,164 - 63,101,508 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,786,913 - 63,800,259 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,638,904 - 61,652,253 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	63,202,601 - 63,220,135 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	63,203,063 - 63,216,410 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	62,388,065 - 62,403,023 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	63,994,097 - 64,007,330 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	59,124,041 - 59,137,372 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

Brodifacoum (EXP)

cadmium dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dorsomorphin (ISO)

esketamine (ISO)

ethanol (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

leflunomide (ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sunitinib (ISO)

thiram (ISO)

titanium dioxide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intermembrane lipid transfer (IEA)

phospholipid transport (IBA,IEA,ISO)

Cellular Component

mitochondrial intermembrane space (IBA,IEA)

mitochondrion (ISO)

Molecular Function

phosphatidic acid transfer activity (IBA,IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:24270810	PMID:26071602	PMID:34800366

Genomics

Comparative Map Data

Prelid3a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	63,268,766 - 63,301,770 (+)	Ensembl				GRCr8
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	61,017,764 - 61,031,883 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	63,088,164 - 63,101,508 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,786,913 - 63,800,259 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,638,904 - 61,652,253 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	63,202,601 - 63,220,135 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	63,203,063 - 63,216,410 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	62,388,065 - 62,403,023 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	63,994,097 - 64,007,330 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	59,124,041 - 59,137,372 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

PRELID3A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	12,407,929 - 12,432,238 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	12,407,896 - 12,432,238 (+)	Ensembl			hg38	GRCh38
GRCh37	18	12,407,928 - 12,432,237 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	12,397,928 - 12,422,234 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	18	12,397,927 - 12,422,234	NCBI
Celera	18	12,288,649 - 12,313,115 (+)	NCBI		Celera
Cytogenetic Map	18	p11.21	NCBI
HuRef	18	12,361,380 - 12,385,810 (+)	NCBI		HuRef
CHM1_1	18	12,407,294 - 12,431,622 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	12,570,904 - 12,595,226 (+)	NCBI		T2T-CHM13v2.0

Prelid3a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	67,595,119 - 67,613,651 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	67,597,936 - 67,612,905 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	67,462,049 - 67,480,581 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	67,464,866 - 67,479,835 (+)	Ensembl			mm10	GRCm38
MGSCv37	18	67,624,503 - 67,640,235 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	67,590,218 - 67,605,950 (+)	NCBI		MGSCv36	mm8
Celera	18	68,747,749 - 68,763,454 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	39.99	NCBI

Prelid3a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	1,016,977 - 1,025,147 (-)	Ensembl
ChiLan1.0	NW_004955402	1,016,977 - 1,027,063 (-)	NCBI	ChiLan1.0	ChiLan1.0

PRELID3A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	25,613,334 - 25,638,623 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	11,305,929 - 11,331,371 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	1,895,635 - 1,920,455 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	17,006,556 - 17,019,054 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	17,006,556 - 17,021,984 (-)	Ensembl			panPan2	panpan1.1

PRELID3A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	77,826,003 - 77,873,568 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	77,832,134 - 77,836,987 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	77,224,539 - 77,274,502 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	77,882,422 - 77,932,501 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	77,882,458 - 77,931,968 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	77,579,176 - 77,629,352 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	77,626,574 - 77,676,778 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	77,913,005 - 77,963,294 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Prelid3a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	885,145 - 893,014 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936626	113,457 - 120,071 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936626	113,461 - 120,669 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRELID3A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	97,146,206 - 97,172,533 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	97,140,129 - 97,200,792 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

PRELID3A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	70,957,851 - 70,980,729 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666050	45,966,717 - 46,007,962 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prelid3a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624770	19,638,991 - 19,646,517 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624770	19,638,982 - 19,647,734 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Prelid3a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	63,811,330 - 63,825,061 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Prelid3a
232 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	67
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000024144
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	54490801	86134022	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	53350521	68120379	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	38575919	83575919	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	45620306	86134022	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	63968306	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	48915737	86134022	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	48915737	86134022	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	45620306	86134022	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61982204	76619168	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	61446853	86134022	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	40462383	85462383	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	54490801	76272247	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61600384	72538878	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	54490801	68120379	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	50795212	86134022	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	62892257	79484461	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	57825243	85493247	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	48915737	86134022	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
1598832	Glom11	Glomerulus QTL 11	2.9		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	53266671	86134022	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	50795212	86134022	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	62892257	79484461	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31610505	72538878	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	52198059	68120379	Rat

Markers in Region

RH132087

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	61,018,140 - 61,018,354 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	63,203,456 - 63,203,669	NCBI	Rnor6.0
Rnor_5.0	18	62,388,728 - 62,388,941	UniSTS	Rnor5.0
RGSC_v3.4	18	63,994,490 - 63,994,703	UniSTS	RGSC3.4
Celera	18	59,124,434 - 59,124,647	UniSTS
RH 3.4 Map	18	616.7	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

BF386932

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	61,026,837 - 61,027,009 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	63,212,153 - 63,212,324	NCBI	Rnor6.0
Rnor_5.0	18	62,397,425 - 62,397,596	UniSTS	Rnor5.0
RGSC_v3.4	18	64,003,072 - 64,003,243	UniSTS	RGSC3.4
Celera	18	59,133,131 - 59,133,302	UniSTS
RH 3.4 Map	18	618.1	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

BF387606

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	61,027,635 - 61,027,788 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	63,212,951 - 63,213,103	NCBI	Rnor6.0
Rnor_5.0	18	62,398,223 - 62,398,375	UniSTS	Rnor5.0
RGSC_v3.4	18	64,003,870 - 64,004,022	UniSTS	RGSC3.4
Celera	18	59,133,929 - 59,134,081	UniSTS
RH 3.4 Map	18	617.6	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	12	67	164	91	90	59	88	59	6	349	188	11	143	79	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254884	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277597	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024144 ⟹ ENSRNOP00000024144

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	63,268,766 - 63,301,770 (+)	Ensembl
mRatBN7.2 Ensembl	18	61,017,764 - 61,031,883 (+)	Ensembl
Rnor_6.0 Ensembl	18	63,203,063 - 63,216,410 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000143863 ⟹ ENSRNOP00000102968

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	63,268,970 - 63,299,346 (+)	Ensembl

RefSeq Acc Id:

NM_001109570 ⟹ NP_001103040

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,287,637 - 63,300,985 (+)	NCBI
mRatBN7.2	18	61,017,748 - 61,031,096 (+)	NCBI
Rnor_6.0	18	63,203,063 - 63,216,410 (+)	NCBI
Rnor_5.0	18	62,388,065 - 62,403,023 (+)	NCBI
RGSC_v3.4	18	63,994,097 - 64,007,330 (+)	RGD
Celera	18	59,124,041 - 59,137,372 (+)	RGD

Sequence:

show sequence

AGAGCGCCGAACTCGCGCCCTGGGCCTGCGGCTGCGGCGATGAAGATCTGGAGCTCGGAGCACG
TGTTCGGCCATCCCTGGGACACGGTGATCAAGGCAGCCATGCGGAAGTACCCTAACCCGATGAA
CCCGTGCGTGGTGGGTGTGGATGTGCTGGAGCGCAGCGTGGATGGCTATGGGCGCCTGCACAGC
CTACGCCTGCTCAGCACCGAATGGGGGCTGCCTGGCCTCGTGCGTGCGATTTTGGGAGCCAACA
GGACCTTGACGTACATCAAAGAGCGCTCTGTCGTGGATCCCGCTGCCAGGAAAATGGAGCTGTG
TTCCACCAATATCACGCTCACGAATCTGGTGTCAGTGAATGAGAGGTTGGTGTACACGCCTCAT
CCAGAGAACCCTGAAAAGACTGTGCTCACTCAAGAAGCCATCATCACTGTGAAGGGGATCAGCC
TTGGGAGCTACCTGGAAAGTCTAATGGCCACCACGATATCCTCCAATGCCAAGAAGGGGTGGGC
TGCCATTGAGTGGATAATTGAACATTCCGAGAGCGCCATAAGCTAACAGGTCTGCACCCATGCC
TGGTGACACAAGGGGCAGTCACAGAAACTTCTTAACCTGATGTCTCACCAAAAAGAGTCAAAGA
AGAAAGGAAAGAAGGAAGTGTGGACAAATAAGACGAGAGGCAAGTGTGGAGTGGCTCCCGCCAA
GTCTGGAAGAGGTATCTGCTGGAATCCTCCTTGTCCACGATAACCTCCCAGTGTAGCATCAGGC
CAAGGCGCCAGCTCTGCGAGGCTGTTTGTGAGAGGCTCTTTCTCGGGAGTGGCGTGGAGCCCTC
GTCTGCTGGGCTCTGCTGTAGGTCCTGTGCTAGGCTGTACTGCCCATGTTGGTTTTAAGCTTTT
ATTTGCTTCTGGAAGGAGTGTCACTTCTTTGTGCTGGCTCTGGACACTCCACCAAGAGAAGAGC
TCCCCTTTCCTCATGCCCTGCAGGCTAAGCTGGGGTAGATCCTGCAAACCTTCTCTAGGGGCCT
GGCTGTTGTCCTCTGTTCCTGGTGACCCTATGTCCTTTATAGTGTCCCACTTGCCTCTGGGAAG
GAGAATGAGAAATTGCTCTCTAGCCCTCAGGGTCCCCATCATGCACTGCATCCAAAAACAGTTC
AGGAGCTCTCTACACAGGCCACTATGAGTTCCAGCAGCAACTGGGATTTTCAAACTCAAAACTG
GCCTTGAACTCTGTGTGACTGAAGATGGTCTTGAACTCTTCCTCCTGCTTCCCCATTCCCAAGT
CCTGAGATTACAGACTTGGGCCGCA

hide sequence

RefSeq Acc Id:

XM_039097131 ⟹ XP_038953059

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI

RefSeq Acc Id:

XM_039097132 ⟹ XP_038953060

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI

RefSeq Acc Id:

XM_039097133 ⟹ XP_038953061

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI

RefSeq Acc Id:

XM_039097134 ⟹ XP_038953062

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,276,701 - 63,301,772 (+)	NCBI
mRatBN7.2	18	61,006,764 - 61,034,821 (+)	NCBI

RefSeq Acc Id:

XM_063277597 ⟹ XP_063133667

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,287,177 - 63,301,772 (+)	NCBI

RefSeq Acc Id:

XM_063277598 ⟹ XP_063133668

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,287,193 - 63,301,772 (+)	NCBI

RefSeq Acc Id:

XM_063277599 ⟹ XP_063133669

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,287,183 - 63,301,772 (+)	NCBI

RefSeq Acc Id:

XR_005496074

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI

RefSeq Acc Id:

XR_005496075

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI

RefSeq Acc Id:

XR_005496076

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,268,824 - 63,301,772 (+)	NCBI
mRatBN7.2	18	60,998,898 - 61,034,821 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001103040	(Get FASTA)	NCBI Sequence Viewer
	XP_038953059	(Get FASTA)	NCBI Sequence Viewer
	XP_038953060	(Get FASTA)	NCBI Sequence Viewer
	XP_038953061	(Get FASTA)	NCBI Sequence Viewer
	XP_038953062	(Get FASTA)	NCBI Sequence Viewer
	XP_063133667	(Get FASTA)	NCBI Sequence Viewer
	XP_063133668	(Get FASTA)	NCBI Sequence Viewer
	XP_063133669	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14731	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024144.4
	ENSRNOP00000102968
	ENSRNOP00000102968.1

RefSeq Acc Id:	NP_001103040 ⟸ NM_001109570
- UniProtKB:	D3ZAN9 (UniProtKB/TrEMBL), A6IXV0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKIWSSEHVFGHPWDTVIKAAMRKYPNPMNPCVVGVDVLERSVDGYGRLHSLRLLSTEWGLPGL VRAILGANRTLTYIKERSVVDPAARKMELCSTNITLTNLVSVNERLVYTPHPENPEKTVLTQEA IITVKGISLGSYLESLMATTISSNAKKGWAAIEWIIEHSESAIS hide sequence

Ensembl Acc Id:

ENSRNOP00000024144 ⟸ ENSRNOT00000024144

RefSeq Acc Id:	XP_038953059 ⟸ XM_039097131
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038953060 ⟸ XM_039097132
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953061 ⟸ XM_039097133
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953062 ⟸ XM_039097134
- Peptide Label:	isoform X3
- UniProtKB:	A6IXU9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133667 ⟸ XM_063277597
- Peptide Label:	isoform X3
- UniProtKB:	A6IXU9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133669 ⟸ XM_063277599
- Peptide Label:	isoform X4
- UniProtKB:	A6IXV0 (UniProtKB/TrEMBL), D3ZAN9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133668 ⟸ XM_063277598
- Peptide Label:	isoform X4
- UniProtKB:	A6IXV0 (UniProtKB/TrEMBL), D3ZAN9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000102968 ⟸ ENSRNOT00000143863

Protein Domains

PRELI/MSF1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZAN9-F1-model_v2	AlphaFold	D3ZAN9	1-172	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700844

Promoter ID:

EPDNEW_R11368

Type:

initiation region

Name:

Prelid3a_1

Description:

PRELI domain containing 3A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	63,203,051 - 63,203,111	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1582858	AgrOrtholog
BioCyc Gene	G2FUF-7140	BioCyc
Ensembl Genes	ENSRNOG00000017954	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024144	ENTREZGENE
	ENSRNOT00000024144.5	UniProtKB/TrEMBL
	ENSRNOT00000143863	ENTREZGENE
	ENSRNOT00000143863.1	UniProtKB/TrEMBL
InterPro	PRELI/MSF1	UniProtKB/TrEMBL
	Slowmo/Ups	UniProtKB/TrEMBL
KEGG Report	rno:690253	UniProtKB/TrEMBL
NCBI Gene	690253	ENTREZGENE
PANTHER	PTHR11158	UniProtKB/TrEMBL
Pfam	PRELI	UniProtKB/TrEMBL
PhenoGen	Prelid3a	PhenoGen
PROSITE	PRELI_MSF1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017954	RatGTEx
UniProt	A0ABK0LCM1_RAT	UniProtKB/TrEMBL
	A6IXU9	ENTREZGENE, UniProtKB/TrEMBL
	A6IXV0	ENTREZGENE, UniProtKB/TrEMBL
	D3ZAN9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-27	Prelid3a	PRELI domain containing 3A	Slmo1	slowmo homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Slmo1	slowmo homolog 1 (Drosophila)	LOC683645	similar to chromosome 18 open reading frame 43	Data merged from RGD:1584507	1643240	APPROVED
2008-03-06	Slmo1	slowmo homolog 1 (Drosophila)	LOC690253	similar to chromosome 18 open reading frame 43	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC690253	similar to chromosome 18 open reading frame 43			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC683645	similar to chromosome 18 open reading frame 43			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message