Advanced Search (OLGA)

Gene: Praf2 (PRA1 domain family, member 2) Rattus norvegicus

Analyze

Symbol:

Praf2

Name:

PRA1 domain family, member 2

RGD ID:

1566287

Description:

Predicted to be active in several cellular components, including GABA-ergic synapse; glutamatergic synapse; and postsynapse. Orthologous to human PRAF2 (PRA1 domain family member 2); INTERACTS WITH 6-propyl-2-thiouracil; aflatoxin B1; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC367743; PRA1 domain family 2; PRA1 family protein 2; RGD1566287; similar to DXImx39e protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRAF2 (PRA1 domain family member 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Praf2 (PRA1 domain family 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Praf2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRAF2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRAF2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Praf2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRAF2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRAF2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Praf2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Praf2 (PRA1 domain family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LIMS1 (LIM zinc finger domain containing 1)	HGNC	OMA
Homo sapiens (human):	LIMS3 (LIM zinc finger domain containing 3)	HGNC	OMA
Homo sapiens (human):	LIMS4 (LIM zinc finger domain containing 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PRAF2 (PRA1 domain family member 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PRAF2 (PRA1 domain family member 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Praf2 (PRA1 domain family 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	praf2 (PRA1 domain family, member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	praf2 (PRA1 domain family, member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Jwa	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Jwa	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	praf-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	praf-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	arl6ip5	Alliance	DIOPT (OrthoFinder\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	17,445,313 - 17,447,950 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	17,445,313 - 17,447,950 (-)	Ensembl				GRCr8
mRatBN7.2	X	14,773,398 - 14,776,035 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	14,773,420 - 14,775,909 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	19,587,417 - 19,590,054 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	20,493,062 - 20,495,699 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	16,758,229 - 16,760,866 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	15,618,324 - 15,620,992 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,618,991 - 15,620,841 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	16,399,546 - 16,402,441 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	X	14,857,586 - 14,860,236 (-)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP)

alpha-Zearalanol (EXP)

amitrole (EXP)

antimycin A (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

carbon nanotube (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

folic acid (ISO)

genistein (ISO)

hydrogen cyanide (ISO)

ivermectin (ISO)

methimazole (EXP)

N-methyl-N-nitrosourea (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

potassium cyanide (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

selenium atom (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tebufenpyrad (ISO)

tetrachloroethene (ISO)

tetrahydropalmatine (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

GABA-ergic synapse (IEA,ISO)

glutamatergic synapse (IEA,ISO)

membrane (IBA,IEA)

postsynapse (IEA,ISO)

presynapse (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Praf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	17,445,313 - 17,447,950 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	17,445,313 - 17,447,950 (-)	Ensembl				GRCr8
mRatBN7.2	X	14,773,398 - 14,776,035 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	14,773,420 - 14,775,909 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	19,587,417 - 19,590,054 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	20,493,062 - 20,495,699 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	16,758,229 - 16,760,866 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	15,618,324 - 15,620,992 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	15,618,991 - 15,620,841 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	16,399,546 - 16,402,441 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	X	14,857,586 - 14,860,236 (-)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

PRAF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	49,071,161 - 49,074,002 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	49,071,161 - 49,074,017 (-)	Ensembl			hg38	GRCh38
GRCh37	X	48,928,818 - 48,931,661 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	48,815,762 - 48,818,606 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	X	48,685,066 - 48,687,911	NCBI
Celera	X	52,732,829 - 52,735,673 (+)	NCBI		Celera
Cytogenetic Map	X	p11.23	NCBI
HuRef	X	46,585,451 - 46,588,295 (-)	NCBI		HuRef
CHM1_1	X	48,960,139 - 48,962,983 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	48,482,886 - 48,485,729 (-)	NCBI		T2T-CHM13v2.0

Praf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	7,594,810 - 7,597,302 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	7,594,678 - 7,597,303 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	X	7,728,571 - 7,731,063 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	7,728,439 - 7,731,064 (+)	Ensembl			mm10	GRCm38
MGSCv37	X	7,305,697 - 7,308,189 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	X	6,885,530 - 6,888,022 (+)	NCBI		MGSCv36	mm8
Celera	X	3,739,495 - 3,741,987 (-)	NCBI		Celera
Cytogenetic Map	X	A1.1	NCBI
cM Map	X	3.48	NCBI

Praf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955543	594,606 - 598,264 (-)	Ensembl
ChiLan1.0	NW_004955543	594,662 - 597,695 (-)	NCBI	ChiLan1.0	ChiLan1.0

PRAF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	50,561,158 - 50,564,080 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	50,564,537 - 50,567,459 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	41,369,432 - 41,372,322 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	49,224,864 - 49,227,782 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	49,224,864 - 49,233,960 (-)	Ensembl			panPan2	panpan1.1

PRAF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	42,218,038 - 42,221,075 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	42,218,046 - 42,226,422 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	16,593,685 - 16,596,572 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	42,354,289 - 42,357,178 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	42,354,298 - 42,357,058 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	42,340,622 - 42,343,507 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	42,328,272 - 42,331,153 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	42,423,017 - 42,425,908 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Praf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	34,731,706 - 34,734,384 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936721	971,744 - 975,580 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936721	972,095 - 974,738 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRAF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	X	43,147,473 - 43,150,350 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	47,995,413 - 47,998,290 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRAF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	46,179,842 - 46,182,769 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	46,179,835 - 46,183,552 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666076	11,745,320 - 11,748,234 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Praf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624893	842,071 - 846,170 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624893	842,293 - 845,494 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Praf2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	X	14,400,017 - 14,402,635 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Praf2
7 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	117
Interacting mature miRNAs:	129
Transcripts:	ENSRNOT00000042525
Prediction methods:	Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	4001493	44939387	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1970440	46970440	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	8111486	53111486	Rat
634325	Bw13	Body weight QTL 13	0		body mass (VT:0001259)	body weight (CMO:0000012)	X	4001493	24470521	Rat

Markers in Region

AI178741

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	14,773,521 - 14,773,758 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	15,618,448 - 15,618,684	NCBI	Rnor6.0
Rnor_5.0	X	16,399,670 - 16,399,906	UniSTS	Rnor5.0
RGSC_v3.4	X	26,812,551 - 26,812,787	UniSTS	RGSC3.4
Celera	X	14,857,710 - 14,857,946	UniSTS
RH 3.4 Map	X	146.9	UniSTS
Cytogenetic Map	X	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
23	12	84	209	91	90	59	155	59	6	481	281	20	187	110	124	31	33	33

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130624	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219908	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000085397 ⟹ ENSRNOP00000068878

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	X	17,445,313 - 17,447,950 (-)	Ensembl
mRatBN7.2 Ensembl	X	14,773,420 - 14,775,909 (-)	Ensembl
Rnor_6.0 Ensembl	X	15,618,991 - 15,620,841 (-)	Ensembl

RefSeq Acc Id:

NM_001109013 ⟹ NP_001102483

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	17,445,313 - 17,447,950 (-)	NCBI
mRatBN7.2	X	14,773,398 - 14,776,035 (-)	NCBI
Rnor_6.0	X	15,618,324 - 15,620,992 (-)	NCBI
Rnor_5.0	X	16,399,546 - 16,402,441 (-)	NCBI
Celera	X	14,857,586 - 14,860,236 (-)	RGD

Sequence:

show sequence

GGTCACACTCATGTCTGCGGCTGCGCAGTATGGTTGCATTGATAGTCGTCGCGTCCTTAGACTC
CATTTCCCAACATGCCTTGCGATGCAGTGAGTGATAACTGGGTGTTGTAGTCTCACCGCCCTTT
GGGCTGGTCCAGCAACCCGCAGGATGTCGGAGGTGCGGCTGCCACCGCTGCGCGCCCTAGACGA
CTTTGTCCTGGGGTCTGCACGTTTGGCAGCTCCTGATCTAGGCGATCCACAACGATGGTGTCAC
CGCGTCATCAACAACCTCCTCTACTACCAAACCAATTACCTTCTCTGCTTTGGCATCAGTCTCG
CTCTGGCCGGGTACATTCGTCCACTGCACACCCTCCTGAGCGCACTGGTAGTGGCGGTGGCCCT
CGGGGTGTTGGTGTGGGCTGCTGAAACCCGTGCTGCTGTGCGCCGCTGCCGTCGCAGTCACCCT
GCTGCCTGCCTGGCTGCAGTACTTGCCGTTAGCCTCTTCATTCTCTGGGCCGTGGGCGGCGCTT
TCACCTTCCTGCTCTGCATCACAGCGCCTGTGCTTTTGATCCTGCTGCATGCTTCACTGCGCCT
GAGAAACCTTAAAAACAAGATTGAGAACAAGATCGAGAGCATCGGTCTAAAGCGGACACCAATG
GGACTGCTTCTAGAGGCACTGGGACAGGAGCAGGAAGCTGGATCCTAGGACCCTGGCAACTATA
CTCTGGATCTAGAGGACCCCCACCCCACACCCAAGACCAAACCTTTCCTAGTCATTAAAACAGG
TGCCTAGAGCCCTCTGGCCTGTCCAAGAAAAGGCACCTGTGACTGCTCACTGCAGCCCCAAACT
GGTCATCTCTTAGCCTCTAGCCCGTCACCGAGGGACCACAGGCTTCCTCAGCCCTCAATTTGAG
ACTCAGTCGCTTACATCCAGCCTTGAAACTGGATTTCTAAGCCACAGCATCTGTGGCCAATCTC
AAAACTGGACCCCAAGATACTCCCCTGACCCAAATGTGGGACTCGATGGTCTTCCATACTTCAA
AGCTAGGCCCTAAGGCAAGACATCCTCAAATCTTGAGCTCTAAAGATTTTTCAGACCCCACACA
ACTTGGAACGTAGGTTAATACCTGGTCAAATCTTGAGCCTAAGTCCAAGTGTCCTCAGCCCTGA
CCACACTGAACCCTTGAATTCAGATAACCCTAACCCTCAGTAGACCCAATAGCCTCCCTCCAAC
TGTTTCAAGGTTCTCTCCCTCCCCCACAATGTTCTCAGTATCAAGGACCAACATGTGGGACTGG
CTAGGGATAGCCCCAGCTGGGAATGGGGCACATATAATAGTGTTGCTACAATAAAGCCTTTGAA
TCTCAAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102483	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL83833	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000068878
	ENSRNOP00000068878.2

RefSeq Acc Id:	NP_001102483 ⟸ NM_001109013
- UniProtKB:	A0A0G2JTX2 (UniProtKB/TrEMBL), A6KP85 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSEVRLPPLRALDDFVLGSARLAAPDLGDPQRWCHRVINNLLYYQTNYLLCFGISLALAGYIRP LHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVSLFILWAVGGAFTFLLCIT APVLLILLHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS hide sequence

Ensembl Acc Id:

ENSRNOP00000068878 ⟸ ENSRNOT00000085397

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701744

Promoter ID:

EPDNEW_R12268

Type:

multiple initiation site

Name:

Praf2_1

Description:

PRA1 domain family, member 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	15,620,864 - 15,620,924	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1566287	AgrOrtholog
BioCyc Gene	G2FUF-2917	BioCyc
Ensembl Genes	ENSRNOG00000057147	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000085397	ENTREZGENE
	ENSRNOT00000085397.3	UniProtKB/TrEMBL
InterPro	Prenylated_rab_accept_PRA1	UniProtKB/TrEMBL
KEGG Report	rno:367743	UniProtKB/TrEMBL
NCBI Gene	367743	ENTREZGENE
PANTHER	PRA1 FAMILY PROTEIN 2	UniProtKB/TrEMBL
	PTHR12859	UniProtKB/TrEMBL
Pfam	PRA1	UniProtKB/TrEMBL
PhenoGen	Praf2	PhenoGen
RatGTEx	ENSRNOG00000057147	RatGTEx
UniProt	A0A0G2JTX2	ENTREZGENE, UniProtKB/TrEMBL
	A6KP85	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-12-15	Praf2	PRA1 domain family, member 2	Praf2	PRA1 domain family 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Praf2	PRA1 domain family 2	Praf2_predicted	PRA1 domain family 2 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Praf2_predicted	PRA1 domain family 2 (predicted)	RGD1566287_predicted	similar to DXImx39e protein (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1566287_predicted	similar to DXImx39e protein (predicted)	LOC367743	similar to DXImx39e protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC367743	similar to DXImx39e protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD