Sgpp2 (sphingosine-1-phosphate phosphatase 2)

Gene: Sgpp2 (sphingosine-1-phosphate phosphatase 2) Rattus norvegicus

Analyze

Symbol:

Sgpp2

Name:

sphingosine-1-phosphate phosphatase 2

RGD ID:

1565739

Description:

Predicted to enable sphingosine-1-phosphate phosphatase activity. Predicted to be involved in phospholipid dephosphorylation; regulation of type B pancreatic cell proliferation; and sphingosine metabolic process. Predicted to be located in endoplasmic reticulum. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human SGPP2 (sphingosine-1-phosphate phosphatase 2); PARTICIPATES IN Fabry disease pathway; Gaucher's disease pathway; Krabbe disease pathway; INTERACTS WITH 6-propyl-2-thiouracil; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

INFERRED

Previously known as:

LOC301543; RGD1565739; similar to Sphingosine-1-phosphate phosphotase 2; sphingosine-1-phosphate phosphotase 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SGPP2 (sphingosine-1-phosphate phosphatase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Sgpp2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sgpp2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SGPP2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SGPP2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sgpp2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SGPP2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SGPP2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sgpp2 (sphingosine-1-phosphate phosphatase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SGPP2 (sphingosine-1-phosphate phosphatase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sgpp2 (sphingosine-1-phosphate phosphatase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sgpp2 (sphingosine-1-phosphate phosphatase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	LCB3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YSR3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sgpp2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	87,211,155 - 87,331,787 (+)	NCBI		GRCr8
mRatBN7.2	9	79,762,658 - 79,884,665 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	79,763,284 - 79,880,457 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	88,193,174 - 88,310,242 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	93,306,052 - 93,422,660 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	91,704,622 - 91,821,684 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	84,203,094 - 84,321,269 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	84,203,072 - 84,319,874 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	83,961,688 - 84,075,946 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	77,679,320 - 77,799,178 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	77,274,290 - 77,388,812 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

cadmium dichloride (ISO)

cadmium sulfate (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

decabromodiphenyl ether (ISO)

dextran sulfate (EXP)

dibutyl phthalate (ISO)

diiodine (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

genistein (EXP,ISO)

hesperidin (EXP)

inulin (ISO)

isobutanol (ISO)

lipopolysaccharide (ISO)

malathion (ISO)

mercury dibromide (ISO)

methyl methanesulfonate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-methyl-4-phenylpyridinium (ISO)

niclosamide (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paraquat (EXP)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

propanal (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tributylstannane (ISO)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

phospholipid dephosphorylation (IBA)

regulation of type B pancreatic cell proliferation (ISO)

sphingosine metabolic process (IBA,ISO)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IBA)

Molecular Function

sphingosine-1-phosphate phosphatase activity (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Fabry disease pathway (ISO)

Gaucher's disease pathway (ISO)

Krabbe disease pathway (ISO)

metachromatic leukodystrophy pathway (ISO)

sphingolipid metabolic pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12411432	PMID:27059959

Genomics

Comparative Map Data

Sgpp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	87,211,155 - 87,331,787 (+)	NCBI		GRCr8
mRatBN7.2	9	79,762,658 - 79,884,665 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	79,763,284 - 79,880,457 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	88,193,174 - 88,310,242 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	93,306,052 - 93,422,660 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	91,704,622 - 91,821,684 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	84,203,094 - 84,321,269 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	84,203,072 - 84,319,874 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	83,961,688 - 84,075,946 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	77,679,320 - 77,799,178 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	9	77,274,290 - 77,388,812 (+)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

SGPP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	222,423,988 - 222,562,621 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	222,424,543 - 222,562,621 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	223,288,707 - 223,427,340 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	222,997,566 - 223,131,861 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	223,114,826 - 223,249,122	NCBI
Celera	2	217,107,484 - 217,191,808 (+)	NCBI		Celera
Cytogenetic Map	2	q36.1	NCBI
HuRef	2	215,143,345 - 215,277,358 (+)	NCBI		HuRef
CHM1_1	2	223,295,733 - 223,430,117 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	222,909,191 - 223,047,956 (+)	NCBI		T2T-CHM13v2.0

Sgpp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	78,286,186 - 78,396,926 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	78,286,982 - 78,396,926 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	78,309,549 - 78,420,289 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	78,310,345 - 78,420,289 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	78,306,921 - 78,416,861 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	78,193,492 - 78,303,436 (+)	NCBI		MGSCv36	mm8
Celera	1	78,786,483 - 78,890,682 (+)	NCBI		Celera
Cytogenetic Map	1	C4	NCBI
cM Map	1	40.23	NCBI

Sgpp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	11,242,647 - 11,359,569 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955453	11,244,077 - 11,361,990 (-)	NCBI	ChiLan1.0	ChiLan1.0

SGPP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	125,041,949 - 125,177,133 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	125,056,920 - 125,192,100 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	109,668,923 - 109,803,950 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	228,300,677 - 228,385,137 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	228,300,673 - 228,381,565 (+)	Ensembl	panpan1.1		panPan2

SGPP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	37	28,536,815 - 28,639,380 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	37	29,372,695 - 29,474,494 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	37	28,560,624 - 28,662,588 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	28,560,568 - 28,661,255 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	37	28,472,739 - 28,574,349 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	37	28,404,302 - 28,505,973 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	37	28,422,422 - 28,524,202 (+)	NCBI		UU_Cfam_GSD_1.0

Sgpp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	178,063,326 - 178,174,545 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936569	4,406,253 - 4,518,655 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936569	4,405,804 - 4,518,637 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SGPP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	124,318,955 - 124,462,851 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	124,316,309 - 124,462,855 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	137,863,888 - 137,960,378 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SGPP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	108,339,433 - 108,480,411 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	90,897,357 - 91,035,535 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sgpp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624823	2,638,257 - 2,756,448 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624823	2,635,128 - 2,756,566 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sgpp2
805 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	23
Count of miRNA genes:	20
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000018882
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	77813894	101597663	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	79271511	91616855	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	9	79271511	91616855	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	79271511	91616855	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	79271511	102910209	Rat

Markers in Region

D9Got91

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	79,842,579 - 79,842,704 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	84,281,399 - 84,281,523	NCBI	Rnor6.0
Rnor_5.0	9	84,040,284 - 84,040,408	UniSTS	Rnor5.0
RGSC_v3.4	9	77,758,668 - 77,758,793	RGD	RGSC3.4
RGSC_v3.4	9	77,758,669 - 77,758,793	UniSTS	RGSC3.4
RGSC_v3.1	9	77,942,088 - 77,942,212	RGD
Celera	9	77,353,135 - 77,353,266	UniSTS
RH 3.4 Map	9	730.1	UniSTS
RH 3.4 Map	9	730.1	RGD
RH 2.0 Map	9	819.2	RGD
Cytogenetic Map	9	q33	UniSTS

D9Mco89

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	79,833,676 - 79,833,926 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	84,272,497 - 84,272,746	NCBI	Rnor6.0
Rnor_5.0	9	84,031,382 - 84,031,631	UniSTS	Rnor5.0
RGSC_v3.4	9	77,749,766 - 77,750,015	UniSTS	RGSC3.4
Celera	9	77,344,239 - 77,344,488	UniSTS
Cytogenetic Map	9	q33	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3								21	23
Low		18	42	26	18	26	2	4	27	12	31	11	2
Below cutoff		20	15	15	1	15	6	7	18		8		6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017596373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039083382	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000018882 ⟹ ENSRNOP00000018882

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	9	84,203,072 - 84,319,874 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102924 ⟹ ENSRNOP00000087628

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	79,763,284 - 79,880,457 (+)	Ensembl

RefSeq Acc Id:

NM_001191811 ⟹ NP_001178740

RefSeq Status:

INFERRED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	87,211,864 - 87,328,926 (+)	NCBI
mRatBN7.2	9	79,763,394 - 79,880,457 (+)	NCBI
Rnor_6.0	9	84,203,094 - 84,317,061 (+)	NCBI
Rnor_5.0	9	83,961,688 - 84,075,946 (+)	NCBI
Celera	9	77,274,290 - 77,388,812 (+)	NCBI

Sequence:

show sequence

ATGGCTGAGCTGCTGCGGAGCCTGAGGGATTCAGAGCTCGTGGCACGCTTCCAGCGGCGCTGCG
GGCTCTTTCCAGGGCAGGAGGCTTCTGGTGAGAAGCATGTTGTGAAGAATTATTTCTACTATTA
CCTGTTCCGGTTTTCAGCTGCTTTGGGTCAGGAGGTGTTCTACATCACATTTCTCCCATTCACC
CACTGGAATATCGACCCTTATTTGTCCAGAAGATTGGTCGTGATATGGGTTTTGGTGATGTACA
TTGGCCAGGTGGCCAAGGACATCCTGAAGTGGCCCCGGCCCTCCTCTCCTCCCGTTGTGAAGCT
TGAAAAGAGAGTGATTGCAGAATATGGAATGCCATCCACCCATGCCATGGCCGCCACCGCCATT
TCTTTCACCCTCCTCATCTCCACCATGGACAGGTACCAGTACCCTTTCATTTTAGGCCTGATCA
TGGCTGTCGTGTTCTCTACACTGGTGAGTCTCAGCAGACTCTACACGGGGATGCACACAGTCCT
GGATGTCCTGGGTGGCGTTCTAATCACGGCGGTCCTCATCGCCCTGACCTACCCTGCCTGGACC
CTCATCGACTCCCTGGACTCCGCCAGCCCTCTCTTCCCTGTGTGTGTCATAGTTGTGCCGTTCC
TCTTGTGCTACAATTACCCTGTGTCCGACTACTACAGCCCGACCAGAGCGGACACCACCACCGT
CGTGGCTGCCGGCGCTGGAGTGACCGTAGGATTCTGGATCAACCACTTCTTCCAGCTCGTGTCC
AAGCCCACCCCGTCCCTCCCTGTGATTCAGAACATCCCCCCCATTACCACTGACATGCTGGTTT
TAGGCCTGACCAAATTTATGGTGGGGATCATGTTGATCCTCTTGGTTCGCCAACTGGTGCAAAA
CCTCTCTCTGCAAGTGTTATTCTCATGGTTCAAGGTGGTTACTAAGAACAAGGAGGCCAGGCGA
AGACTAGAGATTGAAGTCCCTTACAAGTTTGTCACCTACACATCTGTTGGCATCTGTGCCACAA
CCTTTGTGCCAATGTTGCACAGGTTTTTGGGATTGCTCTGAGCCCAAGACAAGCTGGGAACTAG
TCTGCTAATGCGAGATGTGAAATGTGAGAAAGCTGTTG

hide sequence

RefSeq Acc Id:

XM_039083380 ⟹ XP_038939308

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	87,211,155 - 87,331,787 (+)	NCBI
mRatBN7.2	9	79,762,658 - 79,884,665 (+)	NCBI

RefSeq Acc Id:

XM_039083381 ⟹ XP_038939309

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	87,244,490 - 87,331,787 (+)	NCBI
mRatBN7.2	9	79,795,984 - 79,884,665 (+)	NCBI

RefSeq Acc Id:

XM_039083382 ⟹ XP_038939310

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	87,211,650 - 87,301,311 (+)	NCBI
mRatBN7.2	9	79,763,192 - 79,853,934 (+)	NCBI

RefSeq Acc Id:

XM_063266995 ⟹ XP_063123065

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	87,211,648 - 87,328,448 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178740	(Get FASTA)	NCBI Sequence Viewer
	XP_038939308	(Get FASTA)	NCBI Sequence Viewer
	XP_038939309	(Get FASTA)	NCBI Sequence Viewer
	XP_038939310	(Get FASTA)	NCBI Sequence Viewer
	XP_063123065	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000087628
	ENSRNOP00000087628.1

RefSeq Acc Id:

NP_001178740 ⟸ NM_001191811

- UniProtKB:

A0A8I6AGX4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAELLRSLRDSELVARFQRRCGLFPGQEASGEKHVVKNYFYYYLFRFSAALGQEVFYITFLPFT
HWNIDPYLSRRLVVIWVLVMYIGQVAKDILKWPRPSSPPVVKLEKRVIAEYGMPSTHAMAATAI
SFTLLISTMDRYQYPFILGLIMAVVFSTLVSLSRLYTGMHTVLDVLGGVLITAVLIALTYPAWT
LIDSLDSASPLFPVCVIVVPFLLCYNYPVSDYYSPTRADTTTVVAAGAGVTVGFWINHFFQLVS
KPTPSLPVIQNIPPITTDMLVLGLTKFMVGIMLILLVRQLVQNLSLQVLFSWFKVVTKNKEARR
RLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLL

hide sequence

RefSeq Acc Id:

ENSRNOP00000018882 ⟸ ENSRNOT00000018882

RefSeq Acc Id:	XP_038939308 ⟸ XM_039083380
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038939310 ⟸ XM_039083382
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038939309 ⟸ XM_039083381
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000087628 ⟸ ENSRNOT00000102924

RefSeq Acc Id:	XP_063123065 ⟸ XM_063266995
- Peptide Label:	isoform X2

Protein Domains

Phosphatidic acid phosphatase type 2/haloperoxidase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LZ44-F1-model_v2	AlphaFold	F1LZ44	1-354	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696787

Promoter ID:

EPDNEW_R7311

Type:

initiation region

Name:

Sgpp2_1

Description:

sphingosine-1-phosphate phosphatase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	84,203,004 - 84,203,064	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565739	AgrOrtholog
BioCyc Gene	G2FUF-27025	BioCyc
BioCyc Pathway	PWY3DJ-11470 [sphingosine and sphingosine-1-phosphate metabolism]	BioCyc
BioCyc Pathway Image	PWY3DJ-11470	BioCyc
Ensembl Genes	ENSRNOG00000037695	Ensembl
	ENSRNOG00000069992	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000102924	ENTREZGENE
	ENSRNOT00000102924.1	UniProtKB/TrEMBL
Gene3D-CATH	Phosphatidic acid phosphatase type 2/haloperoxidase	UniProtKB/TrEMBL
InterPro	P_Acid_Pase_2/haloperoxi_sf	UniProtKB/TrEMBL
	P_Acid_Pase_2/haloperoxidase	UniProtKB/TrEMBL
KEGG Report	rno:301543	UniProtKB/TrEMBL
NCBI Gene	301543	ENTREZGENE
PANTHER	SPHINGOSINE-1-PHOSPHATE PHOSPHATASE 2	UniProtKB/TrEMBL
	SPHINGOSINE-1-PHOSPHATE PHOSPHOHYDROLASE	UniProtKB/TrEMBL
Pfam	PAP2	UniProtKB/TrEMBL
PhenoGen	Sgpp2	PhenoGen
RatGTEx	ENSRNOG00000037695	RatGTEx
	ENSRNOG00000069992	RatGTEx
SMART	acidPPc	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48317	UniProtKB/TrEMBL
UniProt	A0A8I6AGX4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-01	Sgpp2	sphingosine-1-phosphate phosphatase 2	Sgpp2	sphingosine-1-phosphate phosphotase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Sgpp2	sphingosine-1-phosphate phosphotase 2	RGD1565739_predicted	similar to Sphingosine-1-phosphate phosphotase 2 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1565739_predicted	similar to Sphingosine-1-phosphate phosphotase 2 (predicted)	LOC301543	similar to Sphingosine-1-phosphate phosphotase 2	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC301543	similar to Sphingosine-1-phosphate phosphotase 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways