Advanced Search (OLGA)

Gene: Fam83a (family with sequence similarity 83, member A) Rattus norvegicus

Analyze

Symbol:

Fam83a

Name:

family with sequence similarity 83, member A

RGD ID:

1565606

Description:

Predicted to enable identical protein binding activity; phosphatidylinositol 3-kinase regulatory subunit binding activity; and protein kinase binding activity. Predicted to be involved in several processes, including epidermal growth factor receptor signaling pathway; positive regulation of adipose tissue development; and white fat cell differentiation. Predicted to be located in mitochondrion. Orthologous to human FAM83A (family with sequence similarity 83 member A); INTERACTS WITH bisphenol A; 17beta-estradiol (ortholog); 2,2',4,4'-Tetrabromodiphenyl ether (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC500873; LOC500873; RGD1565606; similar to hypothetical protein MGC14128 isoform a; uncharacterized protein LOC500873

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	91,412,366 - 91,436,819 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	91,412,366 - 91,436,910 (+)	Ensembl				GRCr8
mRatBN7.2	7	89,522,826 - 89,547,284 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	89,522,826 - 89,547,388 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	91,400,071 - 91,424,464 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	93,601,354 - 93,625,746 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	93,419,371 - 93,443,641 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	97,855,773 - 97,880,227 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	97,855,636 - 97,881,955 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	98,462,331 - 98,486,785 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	94,692,898 - 94,717,221 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	86,295,417 - 86,319,863 (+)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Disease Progression (ISO)

Neoplasm Invasiveness (ISO)

Ovarian Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dimethoxyphenol (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butan-1-ol (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

diazinon (ISO)

fulvestrant (ISO)

furfural (ISO)

inulin (ISO)

MK-2206 (ISO)

okadaic acid (ISO)

ozone (ISO)

perfluorooctane-1-sulfonic acid (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium lactate (ISO)

sulforaphane (ISO)

testosterone (ISO)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell population proliferation (IEA,ISO)

epidermal growth factor receptor signaling pathway (IBA,IEA,ISO)

positive regulation of adipose tissue development (IEA,ISO)

white fat cell differentiation (IEA,ISO)

Cellular Component

cytoplasm (IEA,ISO)

mitochondrion (IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO)

phosphatidylinositol 3-kinase regulatory subunit binding (IEA,ISO)

protein binding (ISO)

protein kinase binding (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:22886303	PMID:24736947	PMID:35902548

Genomics

Comparative Map Data

Fam83a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	91,412,366 - 91,436,819 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	91,412,366 - 91,436,910 (+)	Ensembl				GRCr8
mRatBN7.2	7	89,522,826 - 89,547,284 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	89,522,826 - 89,547,388 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	91,400,071 - 91,424,464 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	93,601,354 - 93,625,746 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	93,419,371 - 93,443,641 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	97,855,773 - 97,880,227 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	97,855,636 - 97,881,955 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	98,462,331 - 98,486,785 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	94,692,898 - 94,717,221 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	86,295,417 - 86,319,863 (+)	NCBI		Celera
Cytogenetic Map	7	q33	NCBI

FAM83A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	123,179,047 - 123,210,079 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	123,178,960 - 123,210,079 (+)	Ensembl			hg38	GRCh38
GRCh37	8	124,191,287 - 124,222,319 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	124,263,933 - 124,291,499 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	8	120,383,791 - 120,411,357 (+)	NCBI		Celera
Cytogenetic Map	8	q24.13	NCBI
HuRef	8	119,520,504 - 119,547,938 (+)	NCBI		HuRef
CHM1_1	8	124,235,040 - 124,262,606 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	124,310,090 - 124,341,215 (+)	NCBI		T2T-CHM13v2.0

Fam83a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	57,847,983 - 57,874,102 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	57,848,815 - 57,874,405 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	57,984,587 - 58,010,706 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	57,985,419 - 58,011,009 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	57,817,458 - 57,842,261 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	57,815,993 - 57,825,685 (+)	NCBI		MGSCv36	mm8
Celera	15	59,506,624 - 59,530,729 (+)	NCBI		Celera
Cytogenetic Map	15	D1	NCBI
cM Map	15	24.17	NCBI

Fam83a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955540	2,070,396 - 2,089,665 (+)	Ensembl
ChiLan1.0	NW_004955540	2,070,396 - 2,095,341 (+)	NCBI	ChiLan1.0	ChiLan1.0

FAM83A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	140,612,746 - 140,643,154 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	116,125,306 - 116,153,636 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	119,877,517 - 119,905,848 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	122,633,373 - 122,659,864 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	122,633,373 - 122,661,709 (+)	Ensembl			panPan2	panpan1.1

FAM83A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	21,566,083 - 21,590,291 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	21,566,059 - 21,589,976 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	21,531,225 - 21,555,182 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	21,902,312 - 21,929,536 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	21,901,936 - 21,930,406 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	21,630,684 - 21,658,201 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	21,736,217 - 21,760,846 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	21,979,058 - 22,004,032 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fam83a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	16,693,578 - 16,712,309 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	24,119,636 - 24,138,420 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	24,119,688 - 24,138,413 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAM83A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	16,169,708 - 16,184,941 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	16,169,697 - 16,186,015 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	16,913,828 - 16,929,188 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAM83A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	117,758,303 - 117,786,891 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	117,759,343 - 117,784,691 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	22,445,130 - 22,473,945 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fam83a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	232,313,235 - 232,337,113 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fam83a
240 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	56
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000008330
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	82111245	96700643	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	82111245	95485241	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	11	21	57	57	56	25	64	25	6	175	109	1	36	22	56	31	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001130576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008330 ⟹ ENSRNOP00000008330

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	91,412,366 - 91,436,910 (+)	Ensembl
mRatBN7.2 Ensembl	7	89,522,826 - 89,547,388 (+)	Ensembl
Rnor_6.0 Ensembl	7	97,855,636 - 97,881,955 (+)	Ensembl

RefSeq Acc Id:

NM_001130576 ⟹ NP_001124048

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	91,412,366 - 91,436,819 (+)	NCBI
mRatBN7.2	7	89,522,826 - 89,547,284 (+)	NCBI
Rnor_6.0	7	97,855,773 - 97,880,227 (+)	NCBI
Rnor_5.0	7	98,462,331 - 98,486,785 (+)	NCBI
RGSC_v3.4	7	94,692,898 - 94,717,221 (+)	RGD
Celera	7	86,295,417 - 86,319,863 (+)	RGD

Sequence:

show sequence

GCAAGAGGGGAAGACAGGACTCTGCAAGCCAGTATGGGAAGCCCATAGCGTCTTCCTAGGAATA
CTGGGAGCCCGATTCCTCCCTGGCATTGTCTGCATTCTCCCTACATCTGGAAGAGCTCCAGGAT
TGGCCACCCCTCCACGACTGAGAGACGCGGCAGCATGAGCCGGTCAAGGCATGTGGGCAAGATC
CGGAAACGTCTGGAAGATGTCAAGAACCAGTGGATCCGGCCAGCCAGAGCTGATTTTAGTGATA
ATGAGAGCGCCCGGCTGGCCACAGATGCCCTCTTGGATGGGGGTCCAGAGGCTTATTGGCGCGC
TCTCAGCCAGGAAGGAGAGGTAGACTTCCTGTCCTCGGCAGAGGCCCAGTACATTCAGGATCAG
GCCAAGGAGCCCCCCGGTGCCCCAGATCTTGCAGGAGGGACCGAGTCAGGACCCAGAGGACTGG
ACTCCTGCTCTTTACAATCAGGTACCTACTTCCCTGTGGCTTCGGAAGGCAGTGAACCTGCTCT
GCTACACACCTGGACCTTGGCTGAGAAGCCCTACATGAAGGAAAAGTCCACCGCCACTGTCTAC
TTCCAGATGGACAAACACAACAACATCAGAGACTTGGTCCGCCGCTGCATCTCCCGGGCCAGCC
AGGTCCTGGCCATCCTGATGGATGTGTTCACGGATGTGGAGATCTTTTGTGACATTCTAGAGGC
AGCCAACAAGCGTGGGGTATTTGTCTGTGTGCTTCTGGATCAGGGAGGTGTGAAGCTCTTCCAG
GAGATGTGTGACAAAATCCAGATCTCTGATATTCATCTCAAGAACATCTCCATCAGGAGTGTGG
AGGGGGAGGTGTACTGTGCCAAGTCAGGCAGGAAATTTTCGGGCCAAATCCAAGAGAAGTTCAT
CATCTCAGACTGGAGGTTTGTCTTATCCGGATCATACAGCTTCTCTTGGCTCTGTGGACACGTG
CACAGGAACATCCTCTCCAAGTTCACGGGCCAGGCGGTGGAGCTGTTTGATGAGGAATTTCGAC
GCCTCTACGCCTCCTCCAAGCCCCTGATGGGTCTGAAGTCCCCGAGGCTGGTCGCCCCACTCCA
ATCCAGCAAGGGCCCAGAAGCCCCCAATGGCCGCCTCAGTGGCAGCAGTGACTCTGCCAGTGAC
CGCACCTCCTCCAACCCCTTCAGCAGCCTGTCGACTGGCAGCAACACCCACAACCGGAGTCTAT
CCACGTCTTCAGGGCCGGGCAGTCCCCTGGCCCCCATCCCACCCGTGGTTCCAAGGCTGCAGCC
CTATCACAGTACCCGGAGAGCCGTGGCCCCACAGGATCTCTTGGTCCCCATGAGACCCCATAAG
GGAGCACCAGCTCCCTACAGCAGCCTCATGGCCTACAGGCCCACCCGGCTGCAGCTGCAGGAGC
TCGGCCTGGTGCCCAGGGTGACTCAACCCTGGAGGCCTTTTCTACAGGCCTTACCTCATTTTTG
A

hide sequence

Protein Sequences


Protein RefSeqs	NP_001124048	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM16233	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008330
	ENSRNOP00000008330.4

RefSeq Acc Id:

NP_001124048 ⟸ NM_001130576

- UniProtKB:

D3ZQN0 (UniProtKB/TrEMBL), A6HRI9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRSRHVGKIRKRLEDVKNQWIRPARADFSDNESARLATDALLDGGPEAYWRALSQEGEVDFLS
SAEAQYIQDQAKEPPGAPDLAGGTESGPRGLDSCSLQSGTYFPVASEGSEPALLHTWTLAEKPY
MKEKSTATVYFQMDKHNNIRDLVRRCISRASQVLAILMDVFTDVEIFCDILEAANKRGVFVCVL
LDQGGVKLFQEMCDKIQISDIHLKNISIRSVEGEVYCAKSGRKFSGQIQEKFIISDWRFVLSGS
YSFSWLCGHVHRNILSKFTGQAVELFDEEFRRLYASSKPLMGLKSPRLVAPLQSSKGPEAPNGR
LSGSSDSASDRTSSNPFSSLSTGSNTHNRSLSTSSGPGSPLAPIPPVVPRLQPYHSTRRAVAPQ
DLLVPMRPHKGAPAPYSSLMAYRPTRLQLQELGLVPRVTQPWRPFLQALPHF

hide sequence

Ensembl Acc Id:

ENSRNOP00000008330 ⟸ ENSRNOT00000008330

Protein Domains

Scaffolding anchor of CK1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQN0-F1-model_v2	AlphaFold	D3ZQN0	1-436	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695343

Promoter ID:

EPDNEW_R5867

Type:

single initiation site

Name:

Fam83a_1

Description:

family with sequence similarity 83, member A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	97,855,585 - 97,855,645	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565606	AgrOrtholog
BioCyc Gene	G2FUF-33336	BioCyc
Ensembl Genes	ENSRNOG00000006251	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008330	ENTREZGENE
	ENSRNOT00000008330.7	UniProtKB/TrEMBL
Gene3D-CATH	Endonuclease Chain A	UniProtKB/TrEMBL
InterPro	DUF1669	UniProtKB/TrEMBL
	FAM83	UniProtKB/TrEMBL
KEGG Report	rno:500873	UniProtKB/TrEMBL
NCBI Gene	500873	ENTREZGENE
PANTHER	PROTEIN FAM83A-RELATED	UniProtKB/TrEMBL
	UNCHARACTERIZED	UniProtKB/TrEMBL
Pfam	DUF1669	UniProtKB/TrEMBL
PhenoGen	Fam83a	PhenoGen
RatGTEx	ENSRNOG00000006251	RatGTEx
Superfamily-SCOP	Phospholipase D/nuclease	UniProtKB/TrEMBL
UniProt	A6HRI9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQN0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Fam83a	family with sequence similarity 83, member A	RGD1565606_predicted	similar to hypothetical protein MGC14128 isoform a (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1565606_predicted	similar to hypothetical protein MGC14128 isoform a (predicted)	LOC500873	similar to hypothetical protein MGC14128 isoform a	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500873	similar to hypothetical protein MGC14128 isoform a			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD