Advanced Search (OLGA)

Gene: Rab19 (RAB19, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab19

Name:

RAB19, member RAS oncogene family

RGD ID:

1565263

Description:

Predicted to enable GTPase activity. Predicted to be involved in autophagosome assembly and intracellular protein transport. Predicted to be located in plasma membrane and synaptic vesicle membrane. Predicted to be active in endomembrane system. Orthologous to human RAB19 (RAB19, member RAS oncogene family); INTERACTS WITH acetamide; acrylamide; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC500088; ras-related protein Rab-19; similar to RAB19, member RAS oncogene family

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB19 (RAB19, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rab19 (RAB19, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPIRE2 (spire type actin nucleation factor 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Rab19 (RAB19, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RAB19 (RAB19, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	LOC555645 (ras-related protein Rab-19)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Danio rerio (zebrafish):	rab19 (RAB19, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Danio rerio (zebrafish):	rab19 (RAB19, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	rab-19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rab19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rab19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	69,123,962 - 69,133,691 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	69,123,924 - 69,134,383 (+)	Ensembl				GRCr8
mRatBN7.2	4	68,157,159 - 68,166,889 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	68,156,881 - 68,166,886 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	73,080,369 - 73,090,100 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	69,001,502 - 69,011,233 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	67,406,609 - 67,416,230 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	67,166,412 - 67,176,141 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	67,165,883 - 67,176,363 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	66,972,872 - 66,982,892 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	66,889,446 - 66,899,175 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	63,162,671 - 63,172,399 (+)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

syndactyly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

choline (ISO)

dioxygen (ISO)

endosulfan (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

L-methionine (ISO)

Muraglitazar (EXP)

paracetamol (EXP)

resveratrol (ISO)

rotenone (ISO)

sodium arsenate (ISO)

Tesaglitazar (EXP)

thioacetamide (EXP)

triptonide (ISO)

troglitazone (EXP)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagosome assembly (IBA)

intracellular protein transport (IBA)

Cellular Component

endomembrane system (IBA)

plasma membrane (IEA)

synaptic vesicle membrane (IEA)

Molecular Function

G protein activity (IEA)

GTP binding (IEA)

GTPase activity (IBA,IEA)

hydrolase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:19056867

Genomics

Comparative Map Data

Rab19
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	69,123,962 - 69,133,691 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	69,123,924 - 69,134,383 (+)	Ensembl				GRCr8
mRatBN7.2	4	68,157,159 - 68,166,889 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	68,156,881 - 68,166,886 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	73,080,369 - 73,090,100 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	69,001,502 - 69,011,233 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	67,406,609 - 67,416,230 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	67,166,412 - 67,176,141 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	67,165,883 - 67,176,363 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	66,972,872 - 66,982,892 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	66,889,446 - 66,899,175 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	63,162,671 - 63,172,399 (+)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI

RAB19
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	140,404,058 - 140,427,974 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	140,404,047 - 140,427,974 (+)	Ensembl			hg38	GRCh38
GRCh37	7	140,103,858 - 140,127,774 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	139,753,916 - 139,772,419 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	7	134,825,908 - 134,848,114 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI
HuRef	7	134,397,822 - 134,419,352 (+)	NCBI		HuRef
CHM1_1	7	140,038,750 - 140,060,965 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	141,718,006 - 141,742,144 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	139,432,676 - 139,454,883 (+)	NCBI

Rab19
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	39,357,645 - 39,367,600 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	39,358,109 - 39,367,314 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	39,380,709 - 39,390,666 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	39,381,175 - 39,390,380 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	39,331,427 - 39,340,379 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	39,311,035 - 39,319,987 (+)	NCBI		MGSCv36	mm8
Celera	6	39,366,560 - 39,375,380 (+)	NCBI		Celera
Cytogenetic Map	6	B1	NCBI
cM Map	6	18.16	NCBI

Rab19
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955494	2,878,562 - 2,885,808 (-)	Ensembl
ChiLan1.0	NW_004955494	2,878,562 - 2,885,766 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAB19
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	177,201,128 - 177,223,109 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	29,211,382 - 29,233,363 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	132,345,288 - 132,367,298 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	144,824,042 - 144,844,761 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	144,824,042 - 144,844,761 (+)	Ensembl			panPan2	panpan1.1

RAB19
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	8,544,353 - 8,562,714 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	8,544,804 - 8,562,346 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	9,388,399 - 9,406,743 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	8,465,402 - 8,483,792 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	8,465,559 - 8,483,792 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	8,416,377 - 8,434,728 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	8,260,776 - 8,279,091 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	8,329,152 - 8,347,508 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rab19
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	14,710,515 - 14,713,921 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936592	4,505,882 - 4,509,288 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB19
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	9,364,451 - 9,384,083 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	9,367,239 - 9,391,097 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	9,880,441 - 9,898,173 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB19
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	109,185,241 - 109,205,802 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	109,185,538 - 109,205,453 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666072	5,832,283 - 5,853,124 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab19
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	20,591,230 - 20,598,869 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624765	20,591,236 - 20,598,800 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rab19
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	100,402,150 - 100,411,784 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rab19
46 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	382
Count of miRNA genes:	225
Interacting mature miRNAs:	250
Transcripts:	ENSRNOT00000012280
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58080146	80212111	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	40471453	75939996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
2317577	Eae24	Experimental allergic encephalomyelitis QTL 24			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	67960112	73752811	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	35113290	80113290	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	40490442	75726188	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	58079875	82597589	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	37269577	82269577	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	61041057	94638356	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	58079875	92690793	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	63900458	88813920	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	59603319	80216952	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	7	47	96	91	90	59	92	59	6	330	168	11	69	81	92	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024326	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762820	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125869	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088443	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012280 ⟹ ENSRNOP00000012280

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	69,123,924 - 69,134,383 (+)	Ensembl
mRatBN7.2 Ensembl	4	68,156,881 - 68,166,886 (+)	Ensembl
Rnor_6.0 Ensembl	4	67,165,883 - 67,176,363 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000143537 ⟹ ENSRNOP00000112509

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	69,126,244 - 69,134,383 (+)	Ensembl

RefSeq Acc Id:

NM_001024326 ⟹ NP_001019497

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	69,123,962 - 69,133,691 (+)	NCBI
mRatBN7.2	4	68,157,159 - 68,166,889 (+)	NCBI
Rnor_6.0	4	67,166,412 - 67,176,141 (+)	NCBI
Rnor_5.0	4	66,972,872 - 66,982,892 (+)	NCBI
RGSC_v3.4	4	66,889,446 - 66,899,175 (+)	RGD
Celera	4	63,162,671 - 63,172,399 (+)	RGD

Sequence:

show sequence

CAAGAGGAAGAAGGGGACGGCGGAGGGCTGCAGAGAAAACCAGAAGAAAAAGCAAAAACTACCT
GCTCACCAGCGAGGTGGGAGAGTGCCCAGGTCTGTTCTGGGAAGCCAGAGCCATGCAGTTCTCC
AGCGCAGCCAGAACAGTGGACGAGAACGTGGACTATTTGTTCAAGGTCATCCTTATTGGGGACT
CCAATGTGGGGAAGACGTGTGTGGTTCAGCACTTCAAATCTGGGGTCTACAGTGAGTCACAGCA
GAACACCATTGGGGTGGACTTCACAGTGCGCTCCCTCGAGATAGATGGCAAGAAGGTGAAGATG
CAGGTGTGGGACACTGCAGGCCAGGAGCGCTTCCGTACCATCACCCAAAGCTACTACCGGAGCG
CCCACGCGGCCATTATTGCCTATGACCTCACGCGGCGGTCCACATTCGAGTCTGTCCCTCACTG
GATTCATGAGATAGAGAAATATGGAGCCGCCAACTTGGTCATCATGCTGATCGGGAACAAATCA
GACCTGTGGGAGAAACGCCACGTCCTGTTTGAGGATGCCTGCACACTGGCTGAGAAGTATGGCC
TCCTGGCTGTCTTGGAGACATCCGCCAAAGAGTCCAGGAACATAGATGAAGTCTTTGTGCTCAT
GGCGAAGGAGTTAATTGCCCGAAACAGCCTGCACCTATATGGGGAGAGTGCCCAGCAAGGTCTT
CCCCAGGATTCCAGCCCAGTTCTTGTGGCCCATGTCCCCAGTGAGCGCACTCACTGTACTTGCT
GACCATGTGTGGGAGGCCAGCACACAAGCCAGGGTATCCAGATGCCAGTGTCTCCCCGGTAGCA
TCGAAGGCTGAGCCTTACTGATGGGCAGCACAGACTCTCAGGAAAGGGGACACCACTGTCCTCA
AGGACTCCTATTGAAATGAGGACTTCAGGCCCTGGAGGAAGAGGGTTAGGATGGATTTTTCCCA
TACTGGTCTCTGCCTCCCCAATGCCCAGCAGTTTTATAGTGGAGTTTGCTTCTCTGTTGTACAA
AGACAGTAGTTAAGTAGGGAGCAGGAATATGCAGAAAGGATATTTGGAACATTCTAGATTTGGG
AACAGCCCAGGTACTATTGGGAAAGGCCTGTAATGAAAAGTCAGCCTGCTTTCCAACAGTCAAC
ACAACCAGGCCTTCTTCCTGAGGAGCAAGGCCTTTTGACCTAGAAGCCAGCAATGCCTTCTTGC
TTCTTGGTTAGGAACTAGGAGGCAGATAGAACTGGCTTGCCCTCTGTTAATCTGTTTGACCAAG
AATTCTTAAAACATCAAAATATCTCCTGTACAGAAGTCAGTCCTGCGTTGAAATTAAATTGTCC
TTACATTATTAGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001019497	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88443	(Get FASTA)	NCBI Sequence Viewer
	EDM15384	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012280
GenBank Protein	Q5M7U5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019497 ⟸ NM_001024326

- UniProtKB:

Q5M7U5 (UniProtKB/Swiss-Prot), A6IEU7 (UniProtKB/TrEMBL), A0A8L2Q5E6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQFSSAARTVDENVDYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGK
KVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLI
GNKSDLWEKRHVLFEDACTLAEKYGLLAVLETSAKESRNIDEVFVLMAKELIARNSLHLYGESA
QQGLPQDSSPVLVAHVPSERTHCTC

hide sequence

Ensembl Acc Id:

ENSRNOP00000012280 ⟸ ENSRNOT00000012280

Ensembl Acc Id:

ENSRNOP00000112509 ⟸ ENSRNOT00000143537

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M7U5-F1-model_v2	AlphaFold	Q5M7U5	1-217	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565263	AgrOrtholog
BioCyc Gene	G2FUF-45190	BioCyc
Ensembl Genes	ENSRNOG00000009030	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000012280	ENTREZGENE
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7126386	IMAGE-MGC_LOAD
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Rab19/43	UniProtKB/Swiss-Prot
	Rab_GTPases_membrane_traffic	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:500088	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95086	IMAGE-MGC_LOAD
NCBI Gene	500088	ENTREZGENE
PANTHER	DRAB11-RELATED	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rab19	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009030	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8L2Q5E6	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0M4Y8_RAT	UniProtKB/TrEMBL
	A6IEU7	ENTREZGENE, UniProtKB/TrEMBL
	Q5M7U5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-05	Rab19	RAB19, member RAS oncogene family	LOC500088	similar to RAB19, member RAS oncogene family	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC500088	similar to RAB19, member RAS oncogene family			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar