Advanced Search (OLGA)

Gene: Smim20 (small integral membrane protein 20) Rattus norvegicus

Analyze

Symbol:

Smim20

Name:

small integral membrane protein 20

RGD ID:

1565192

Description:

Predicted to be involved in mitochondrial cytochrome c oxidase assembly. Predicted to be located in extracellular region; membrane; and mitochondrion. Predicted to be active in mitochondrial inner membrane. Orthologous to human SMIM20 (small integral membrane protein 20); INTERACTS WITH 1-naphthyl isothiocyanate; bisphenol A; dibutyl phthalate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC501923; LOC501923; mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 7 kDa; MITRAC7; phoenixin; PNX; RGD1565192; similar to 1810013D10Rik protein; uncharacterized protein LOC501923

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SMIM20 (small integral membrane protein 20)	HGNC	HomoloGene, NCBI
Mus musculus (house mouse):	Smim20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Smim20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SMIM20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SMIM20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Smim20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SMIM20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SMIM20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Smim20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Smim20 (small integral membrane protein 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Smim20 (small integral membrane protein 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Smim20 (small integral membrane protein 20)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SMIM20 (small integral membrane protein 20)	Alliance	DIOPT (Ensembl Compara\|HGNC\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SMIM20 (small integral membrane protein 20)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	smim20 (small integral membrane protein 20)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG34242	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG34242	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	smim20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	61,924,155 - 61,935,630 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	61,923,659 - 61,935,532 (-)	Ensembl				GRCr8
mRatBN7.2	14	57,711,304 - 57,722,681 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	57,711,307 - 57,722,681 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	62,113,099 - 62,124,466 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	63,424,314 - 63,435,694 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	59,821,078 - 59,832,459 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	60,057,493 - 60,069,870 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	14	60,179,583 - 60,190,533 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	62,461,060 - 62,470,889 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	56,813,315 - 56,824,681 (-)	NCBI		Celera
Cytogenetic Map	14	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (ISO)

folic acid (ISO)

hexadecanoic acid (ISO)

lipopolysaccharide (ISO)

nitrates (ISO)

oleic acid (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctanoic acid (ISO)

quercetin (ISO)

rotenone (ISO)

sodium arsenite (ISO)

testosterone (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial respiratory chain complex IV assembly (IBA,IEA,ISO)

Cellular Component

extracellular region (IEA)

membrane (IEA)

mitochondrial inner membrane (IBA,IEA,ISO)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7667285	PMID:8889548	PMID:22963497	PMID:26321642	PMID:31637758	PMID:33059202	PMID:33928538	PMID:38870753

Genomics

Comparative Map Data

Smim20
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	61,924,155 - 61,935,630 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	61,923,659 - 61,935,532 (-)	Ensembl				GRCr8
mRatBN7.2	14	57,711,304 - 57,722,681 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	57,711,307 - 57,722,681 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	62,113,099 - 62,124,466 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	63,424,314 - 63,435,694 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	59,821,078 - 59,832,459 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	60,057,493 - 60,069,870 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	14	60,179,583 - 60,190,533 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	62,461,060 - 62,470,889 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	56,813,315 - 56,824,681 (-)	NCBI		Celera
Cytogenetic Map	14	q11	NCBI

SMIM20
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	25,914,220 - 25,929,812 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	25,861,830 - 25,929,813 (+)	Ensembl			hg38	GRCh38
GRCh37	4	25,915,842 - 25,931,434 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	25,524,626 - 25,540,611 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	4	26,363,965 - 26,380,057 (+)	NCBI		Celera
Cytogenetic Map	4	p15.2	NCBI
HuRef	4	25,254,090 - 25,269,776 (+)	NCBI		HuRef
CHM1_1	4	25,915,589 - 25,931,294 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	25,896,311 - 25,911,902 (+)	NCBI		T2T-CHM13v2.0

Smim20
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	53,424,448 - 53,435,882 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	53,424,425 - 53,435,882 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	53,267,106 - 53,278,540 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	53,267,083 - 53,278,540 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	53,658,345 - 53,669,779 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	53,551,738 - 53,566,791 (+)	NCBI		MGSCv36	mm8
Celera	5	50,647,813 - 50,659,239 (+)	NCBI		Celera
Cytogenetic Map	5	C1	NCBI
cM Map	5	29.05	NCBI

Smim20
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	19,243,419 - 19,253,798 (-)	Ensembl
ChiLan1.0	NW_004955443	19,242,776 - 19,254,002 (-)	NCBI	ChiLan1.0	ChiLan1.0

SMIM20
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	26,153,851 - 26,175,973 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	26,356,606 - 26,371,517 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	20,312,816 - 20,327,746 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	25,591,220 - 25,606,393 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	25,591,220 - 25,606,393 (+)	Ensembl			panPan2	panpan1.1

SMIM20
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	84,481,897 - 84,494,863 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	84,481,901 - 84,494,833 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	86,993,124 - 87,005,974 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	85,451,073 - 85,463,991 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	85,449,481 - 85,463,978 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	84,572,599 - 84,585,453 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	84,692,674 - 84,705,528 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	85,077,331 - 85,090,191 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Smim20
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	50,045,100 - 50,053,417 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	3,746,766 - 3,755,070 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936477	3,746,766 - 3,755,075 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SMIM20
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	8	19,701,022 - 19,714,563 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	20,091,900 - 20,105,894 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SMIM20
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	24,413,717 - 24,436,003 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666047	70,929,248 - 70,944,265 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Smim20
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	6,626,527 - 6,635,786 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624755	6,625,911 - 6,635,894 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Smim20
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	52,860,075 - 52,871,507 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Smim20
113 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	38023710	83023710	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39009444	84009444	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	31238080	72970315	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	38023710	83023710	Rat
7387267	Uae42	Urinary albumin excretion QTL 42		0.61	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	14	22521517	67521517	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18895192	63895192	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	38023710	83023710	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	38023710	83023710	Rat

Markers in Region

RH131307

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	57,711,434 - 57,711,630 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	60,057,624 - 60,057,818	NCBI	Rnor6.0
Rnor_5.0	14	60,179,582 - 60,179,776	UniSTS	Rnor5.0
Celera	14	56,813,447 - 56,813,641	UniSTS
Cytogenetic Map	14	q11	UniSTS

RH143720

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	57,711,448 - 57,711,697 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	60,057,637 - 60,057,885	NCBI	Rnor6.0
Rnor_5.0	14	60,179,595 - 60,179,843	UniSTS	Rnor5.0
Celera	14	56,813,460 - 56,813,708	UniSTS
RH 3.4 Map	14	453.68	UniSTS
Cytogenetic Map	14	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	hemolymphoid system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	sensory system	visual system
7	1	18	52	67	138	95	11	51	36	32	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA685674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB726498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV795217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219849	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226486	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000084451 ⟹ ENSRNOP00000081190

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	61,923,659 - 61,935,532 (-)	Ensembl
mRatBN7.2 Ensembl	14	57,711,307 - 57,722,681 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091794 ⟹ ENSRNOP00000088034

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	57,711,309 - 57,722,648 (-)	Ensembl

RefSeq Acc Id:

NM_001134639 ⟹ NP_001128111

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	61,924,155 - 61,935,532 (-)	NCBI
mRatBN7.2	14	57,711,304 - 57,722,681 (-)	NCBI
Rnor_6.0	14	60,057,493 - 60,069,870 (-)	NCBI
Rnor_5.0	14	60,179,583 - 60,190,533 (-)	NCBI
RGSC_v3.4	14	62,461,060 - 62,470,889 (-)	RGD
Celera	14	56,813,315 - 56,824,681 (-)	RGD

Sequence:

show sequence

CTCCGCCTCTTCCGAGCCGGGTCGCGACCTTAAGGCTGGGAGTCGGGTTTCGGAGCGTGCCGGG
CCTTCGCCCGCCCTGCAGCCCCCTTTCTCACCATGGCCGCGGCCCGGAACCTGCGCACCGCGCT
CATATTCGGAGGCTTCATCTCTATGGTCGGAGCCGCCTTCTACCCTATCTACTTCCGGCCCCTT
CTGCGGCTGGAAGAATACCAGAAGGAGCAGGCTGTAAATCGAGCTGGTATCGTCCAGGAAGATG
TGCAGCCACCAGGGTTGAAAGTGTGGTCTGATCCGTTTGGCAGGAAATGAGGCTGTCAGCAAGT
CTGATGAGGAAAGTGGACATCTTCATCCTGTGCACTCTGCAGTGAGGACAATAGATGGCTCACT
GTGGCAGCCTGGCTGAGAGGGAACTCTCATGCTGCTAGCCAGAGCCCTTGTGATAGAGACTGTG
TGCAAAGACAGTGCTTCCCTTAACTCCCTGGAGAACCTGAACAGATGACACCATTAAGAAGTAC
CTTGTGGCTCCATTGACTTTGCAGGAGCAGAGCCAGCCTGCAAGGCTGTTTGCGGATCTGCAGC
TCATGCAGTCTTTATCACGTCCCAGCTGAGATGTGAACACCAGCAACCTGTGGCTCAAGGCCCT
CGGCTGCTTTGACACCTTCTGAATAAGCGATTTTAGTGCAGATGGCCCAGCCACACTGCCTCCA
ATGGCTCTTTGAGGATGTTTCGATTGATAAAGCTGTTTGAAAACAGGATCCTTGGCACTGTTCA
GGAATGTATACTGCTCAGCTTAACCATCTCATCGAAAGTCACCGTGTGTGGAAGTAAATAGAAG
CAAGTCACTCTAGACTGTACCACACACAGTTGAATCCTGCGTGAGCCTGCAGATATTAAAATGG
TTTCTCTTAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063273503 ⟹ XP_063129573

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	61,924,155 - 61,935,630 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001128111	(Get FASTA)	NCBI Sequence Viewer
	XP_063129573	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	C0HLM6	(Get FASTA)	NCBI Sequence Viewer
	EDL99871	(Get FASTA)	NCBI Sequence Viewer
	EDL99872	(Get FASTA)	NCBI Sequence Viewer
	EDL99873	(Get FASTA)	NCBI Sequence Viewer
	EDL99874	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001128111 ⟸ NM_001134639
- UniProtKB:	C0HLM6 (UniProtKB/Swiss-Prot), A6IJF8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAARNLRTALIFGGFISMVGAAFYPIYFRPLLRLEEYQKEQAVNRAGIVQEDVQPPGLKVWSD PFGRK hide sequence

Ensembl Acc Id:

ENSRNOP00000081190 ⟸ ENSRNOT00000084451

Ensembl Acc Id:

ENSRNOP00000088034 ⟸ ENSRNOT00000091794

RefSeq Acc Id:	XP_063129573 ⟸ XM_063273503
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-C0HLM6-F1-model_v2	AlphaFold	C0HLM6	1-69	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565192	AgrOrtholog
BioCyc Gene	G2FUF-15609	BioCyc
Ensembl Genes	ENSRNOG00000051190	Ensembl
InterPro	SMIM20	UniProtKB/Swiss-Prot
KEGG Report	rno:501923	UniProtKB/Swiss-Prot
NCBI Gene	501923	ENTREZGENE
PANTHER	PTHR34923	UniProtKB/Swiss-Prot
	SMALL INTEGRAL MEMBRANE PROTEIN 20	UniProtKB/Swiss-Prot
Pfam	DUF4538	UniProtKB/Swiss-Prot
PhenoGen	Smim20	PhenoGen
RatGTEx	ENSRNOG00000051190	RatGTEx
UniProt	A0A8I5ZUJ5_RAT	UniProtKB/TrEMBL
	A6IJF8	ENTREZGENE, UniProtKB/TrEMBL
	C0HLM6	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-20	Smim20	small integral membrane protein 20	RGD1565192	similar to 1810013D10Rik protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1565192	similar to 1810013D10Rik protein	RGD1565192_predicted	similar to 1810013D10Rik protein (predicted)	'predicted' is removed	2292626	APPROVED
2008-01-09	RGD1565192_predicted	similar to 1810013D10Rik protein (predicted)	LOC679333	hypothetical protein LOC679333	Data merged from RGD:1589539	1643240	APPROVED
2006-11-19	LOC679333	hypothetical protein LOC679333			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1565192_predicted	similar to 1810013D10Rik protein (predicted)	LOC501923	similar to 1810013D10Rik protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC501923	similar to 1810013D10Rik protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message