Advanced Search (OLGA)

Gene: Scgb3a2 (secretoglobin, family 3A, member 2) Rattus norvegicus

Analyze

Symbol:

Scgb3a2

Name:

secretoglobin, family 3A, member 2

RGD ID:

1564790

Description:

Predicted to be located in extracellular region. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in allergic rhinitis and asthma. Orthologous to human SCGB3A2 (secretoglobin family 3A member 2); INTERACTS WITH bisphenol A; cefaloridine; 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

pneumo secretory protein 1; Pnsp1; secretoglobin family 3A member 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Candidate Gene For:

Eau7

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	36,183,745 - 36,186,667 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	36,183,698 - 36,186,742 (+)	Ensembl				GRCr8
mRatBN7.2	18	35,932,840 - 35,935,762 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	35,932,840 - 35,935,762 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	36,036,856 - 36,039,778 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	36,755,178 - 36,758,100 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	36,132,113 - 36,135,035 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	38,292,822 - 38,295,744 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	38,292,701 - 38,295,831 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	37,950,632 - 37,953,554 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	37,200,474 - 37,203,396	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Cytogenetic Map	18	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic rhinitis (ISO)

asthma (ISO)

Lung Neoplasms (ISO)

lung non-small cell carcinoma (ISO)

pulmonary fibrosis (ISO)

rhinitis (ISO)

sinusitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

DDE (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

methylmercury chloride (ISO)

naphthalene (ISO)

nickel atom (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

PCB138 (ISO)

pioglitazone (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

Cellular Component

extracellular region (IEA,ISO)

extracellular space (IBA,IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Variation in Uteroglobin-Related Protein 1 (UGRP1) gene is associated with allergic rhinitis in Singapore Chinese.	Andiappan AK, etal., BMC Med Genet. 2011 Mar 16;12:39.
2.	Decreased expression of uteroglobin-related protein 1 in inflamed mouse airways is mediated by IL-9.	Chiba Y, etal., Am J Physiol Lung Cell Mol Physiol. 2004 Dec;287(6):L1193-8.
3.	Uteroglobin-related protein 1 expression suppresses allergic airway inflammation in mice.	Chiba Y, etal., Am J Respir Crit Care Med. 2006 May 1;173(9):958-64. Epub 2006 Feb 2.
4.	Uteroglobin-related protein 1 and clara cell protein in induced sputum of patients with asthma and rhinitis.	de Burbure C, etal., Chest. 2007 Jan;131(1):172-9.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Plasma UGRP1 levels associate with promoter G-112A polymorphism and the severity of asthma.	Inoue K, etal., Allergol Int. 2008 Mar;57(1):57-64. Epub 2008 Mar 1.
7.	Secretoglobin 3A2 suppresses bleomycin-induced pulmonary fibrosis by transforming growth factor beta signaling down-regulation.	Kurotani R, etal., J Biol Chem. 2011 Jun 3;286(22):19682-92. Epub 2011 Apr 10.
8.	Secretoglobin 3A2/uteroglobin-related protein 1 is a novel marker for pulmonary carcinoma in mice and humans.	Kurotani R, etal., Lung Cancer. 2011 Jan;71(1):42-8. Epub 2010 May 13.
9.	The cytokine-driven regulation of secretoglobins in normal human upper airway and their expression, particularly that of uteroglobin-related protein 1, in chronic rhinosinusitis.	Lu X, etal., Respir Res. 2011 Mar 8;12:28.
10.	A polymorphism in the human UGRP1 gene promoter that regulates transcription is associated with an increased risk of asthma.	Niimi T, etal., Am J Hum Genet. 2002 Mar;70(3):718-25. Epub 2002 Jan 25.
11.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Comprehensive gene review and curation	RGD comprehensive gene curation
15.	Uteroglobin-related protein 1 gene -112G/a polymorphism and atopic asthma in Sicilian children.	Rigoli L, etal., Allergy Asthma Proc. 2007 Nov-Dec;28(6):667-70.
16.	Expression of secretoglobin3A2 (SCGB3A2) in primary pulmonary carcinomas.	Tachihara-Yoshikawa M, etal., Fukushima J Med Sci. 2008 Dec;54(2):61-72.

Additional References at PubMed

PMID:11682631

Genomics

Comparative Map Data

Scgb3a2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	36,183,745 - 36,186,667 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	36,183,698 - 36,186,742 (+)	Ensembl				GRCr8
mRatBN7.2	18	35,932,840 - 35,935,762 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	35,932,840 - 35,935,762 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	36,036,856 - 36,039,778 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	36,755,178 - 36,758,100 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	36,132,113 - 36,135,035 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	38,292,822 - 38,295,744 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	38,292,701 - 38,295,831 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	37,950,632 - 37,953,554 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	37,200,474 - 37,203,396	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Cytogenetic Map	18	q11	NCBI

SCGB3A2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	147,878,711 - 147,882,191 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	147,869,800 - 147,882,197 (+)	Ensembl			hg38	GRCh38
GRCh37	5	147,258,274 - 147,261,754 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	147,238,467 - 147,241,946 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	147,238,466 - 147,241,946	NCBI
Celera	5	143,339,072 - 143,342,554 (+)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI
HuRef	5	142,405,638 - 142,409,120 (+)	NCBI		HuRef
CHM1_1	5	146,690,622 - 146,694,104 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	148,414,414 - 148,417,894 (+)	NCBI		T2T-CHM13v2.0

Scgb3a2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	43,897,346 - 43,900,464 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	43,897,354 - 43,900,464 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	43,764,301 - 43,767,399 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	43,764,289 - 43,767,399 (+)	Ensembl			mm10	GRCm38
MGSCv37	18	43,923,981 - 43,927,053 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	43,889,658 - 43,892,730 (+)	NCBI		MGSCv36	mm8
Celera	18	45,144,563 - 45,147,636 (+)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI
cM Map	18	23.49	NCBI

Scgb3a2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	6,331,535 - 6,335,462 (-)	Ensembl
ChiLan1.0	NW_004955415	6,332,121 - 6,335,474 (-)	NCBI	ChiLan1.0	ChiLan1.0

SCGB3A2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	143,124,000 - 143,127,710 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	141,263,551 - 141,267,261 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	143,319,941 - 143,323,625 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	149,329,450 - 149,332,929 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	149,329,201 - 149,333,003 (+)	Ensembl			panPan2	panpan1.1

SCGB3A2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	42,147,596 - 42,151,224 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	42,147,596 - 42,151,191 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	39,188,164 - 39,191,790 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	42,601,799 - 42,605,426 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	42,601,799 - 42,605,393 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	39,677,192 - 39,680,817 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	40,487,983 - 40,491,606 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	41,310,909 - 41,314,532 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Scgb3a2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	145,359,646 - 145,362,956 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	6,933,769 - 6,936,838 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	6,933,641 - 6,936,838 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCGB3A2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	149,068,946 - 149,124,983 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	149,120,652 - 149,124,614 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	155,683,158 - 155,686,843 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SCGB3A2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	50,327,428 - 50,417,518 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	50,414,139 - 50,417,373 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666034	27,349,100 - 27,437,601 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scgb3a2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	7,305,239 - 7,308,592 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624774	7,305,272 - 7,308,514 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Scgb3a2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	23,978,703 - 23,981,753 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Scgb3a2
15 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	37
Interacting mature miRNAs:	40
Transcripts:	ENSRNOT00000037796
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	22015562	61600538	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	63968306	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4482648	49482648	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	54490981	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
11565454	Kidm59	Kidney mass QTL 59		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	7065728	52065728	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	4307354	49307354	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
2301409	Cm70	Cardiac mass QTL 70		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	18	7065728	52065728	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
12904716	Am21	Aortic mass QTL 21		0.005	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	7065728	52065728	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
12904714	Cm131	Cardiac mass QTL 131		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	7065728	52065728	Rat
12904715	Cm132	Cardiac mass QTL 132		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	7065728	52065728	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	15226101	42690662	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5460455	42690191	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	44930869	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	12066482	57066482	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31610505	72538878	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
3	8	8	18	24	34	8	15	8	2	79	32	9	29	13	26

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF439547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037796 ⟹ ENSRNOP00000038104

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	36,183,698 - 36,186,431 (+)	Ensembl
mRatBN7.2 Ensembl	18	35,932,840 - 35,935,526 (+)	Ensembl
Rnor_6.0 Ensembl	18	38,292,701 - 38,295,831 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113033 ⟹ ENSRNOP00000077064

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	35,934,879 - 35,935,762 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000126151 ⟹ ENSRNOP00000105178

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	36,183,698 - 36,186,742 (+)	Ensembl

RefSeq Acc Id:

NM_001024283 ⟹ NP_001019454

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	36,183,745 - 36,186,667 (+)	NCBI
mRatBN7.2	18	35,932,840 - 35,935,762 (+)	NCBI
Rnor_6.0	18	38,292,822 - 38,295,744 (+)	NCBI
Rnor_5.0	18	37,950,632 - 37,953,554 (+)	NCBI
RGSC_v3.4	18	37,200,474 - 37,203,396 (+)	RGD

Sequence:

show sequence

TTTCTGTCTACATTCCAAAGTCCAAGAAAACATCAGAGGAACCAGCTATGAAGGTGGTACCCAT
CTTTCTGCTGGTGACGATCGGTATTTGTGGTTATTCTGCCACTGCCTTTCTTATCAACAGTGTC
CCTCTTCCTGTTGACAAAGTGTTACCTTTACCTTTGGACAACCTTATTCCCTTATTTGATCCCT
TGAAGATGCTTCTGAAAACCCTGGGAATTTCTGTAGAACATCTGGTGGAAGGGCTGAAGAAGTG
CGTGAATGAGCTGGGGCCAGAGGCTTCAGAGGCTGTGAAGAAGCTTCTGGAGGCTCTATCACAC
CTGGTATAAAATCTGCATAAACAGATTTAAGGTGCGAGTGAAGAGAAGGATGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001019454	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ04562	(Get FASTA)	NCBI Sequence Viewer
	EDL84763	(Get FASTA)	NCBI Sequence Viewer
	EDL84764	(Get FASTA)	NCBI Sequence Viewer
	EDL84765	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038104.5
	ENSRNOP00000105178
	ENSRNOP00000105178.1

RefSeq Acc Id:	NP_001019454 ⟸ NM_001024283
- UniProtKB:	Q71MM7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKVVPIFLLVTIGICGYSATAFLINSVPLPVDKVLPLPLDNLIPLFDPLKMLLKTLGISVEHLV EGLKKCVNELGPEASEAVKKLLEALSHLV hide sequence

Ensembl Acc Id:

ENSRNOP00000038104 ⟸ ENSRNOT00000037796

Ensembl Acc Id:

ENSRNOP00000077064 ⟸ ENSRNOT00000113033

Ensembl Acc Id:

ENSRNOP00000105178 ⟸ ENSRNOT00000126151

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q71MM7-F1-model_v2	AlphaFold	Q71MM7	1-93	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700756

Promoter ID:

EPDNEW_R11280

Type:

multiple initiation site

Name:

Scgb3a2_1

Description:

secretoglobin, family 3A, member 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	38,292,775 - 38,292,835	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564790	AgrOrtholog
BioCyc Gene	G2FUF-7676	BioCyc
Ensembl Genes	ENSRNOG00000026912	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000037796.7	UniProtKB/TrEMBL
	ENSRNOT00000126151	ENTREZGENE
	ENSRNOT00000126151.1	UniProtKB/TrEMBL
InterPro	Secretoglobin_3A	UniProtKB/TrEMBL
KEGG Report	rno:498854	UniProtKB/TrEMBL
NCBI Gene	498854	ENTREZGENE
PANTHER	PTHR34829	UniProtKB/TrEMBL
	SECRETOGLOBIN FAMILY 3A MEMBER 2	UniProtKB/TrEMBL
Pfam	SCGB3A	UniProtKB/TrEMBL
PhenoGen	Scgb3a2	PhenoGen
RatGTEx	ENSRNOG00000026912	RatGTEx
UniProt	A0ABK0LK60_RAT	UniProtKB/TrEMBL
	F7FAW3_RAT	UniProtKB/TrEMBL
	Q71MM7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Scgb3a2	secretoglobin, family 3A, member 2	Pnsp1	pneumo secretory protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Pnsp1	pneumo secretory protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM