Symbol:
Igsf9b
Name:
immunoglobulin superfamily, member 9B
RGD ID:
1564717
Description:
Predicted to enable kinase binding activity. Predicted to be involved in synaptic membrane adhesion. Predicted to act upstream of or within homophilic cell adhesion via plasma membrane adhesion molecules and positive regulation of inhibitory postsynaptic potential. Is active in GABA-ergic synapse and postsynaptic specialization of symmetric synapse. Orthologous to human IGSF9B (immunoglobulin superfamily member 9B); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC315510; RGD1564717; similar to immunoglobulin superfamily, member 9
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IGSF9B (immunoglobulin superfamily member 9B) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Igsf9b (immunoglobulin superfamily, member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Igsf9b (immunoglobulin superfamily member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IGSF9B (immunoglobulin superfamily member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IGSF9B (immunoglobulin superfamily member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Igsf9b (immunoglobulin superfamily member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IGSF9B (immunoglobulin superfamily member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IGSF9B (immunoglobulin superfamily member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Igsf9b (immunoglobulin superfamily member 9B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
IGSF9B (immunoglobulin superfamily member 9B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Igsf9b (immunoglobulin superfamily, member 9B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
igsf9ba (immunoglobulin superfamily, member 9Ba)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
igsf9bb (immunoglobulin superfamily, member 9Bb)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
igcm-2
Alliance
DIOPT (OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
tutl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
igsf9b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 33,971,779 - 34,027,390 (+) NCBI GRCr8 mRatBN7.2 8 25,712,644 - 25,769,481 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 25,712,644 - 25,758,554 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 29,754,600 - 29,800,497 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 28,048,896 - 28,094,798 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 25,928,882 - 25,974,781 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 28,352,497 - 28,398,659 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 28,352,772 - 28,387,383 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 28,371,484 - 28,417,964 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 26,905,723 - 26,941,081 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 27,199,908 - 27,245,801 (+) NCBI Celera Cytogenetic Map 8 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Igsf9b Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of IGSF9B mRNA CTD PMID:29097150 Igsf9b Rat 17beta-estradiol increases expression ISO IGSF9B (Homo sapiens) 6480464 Estradiol results in increased expression of IGSF9B mRNA CTD PMID:31614463 Igsf9b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Igsf9b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Igsf9b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Igsf9b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Igsf9b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IGSF9B mRNA CTD PMID:33387578 Igsf9b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Igsf9b Rat 4,4'-sulfonyldiphenol decreases methylation ISO IGSF9B (Homo sapiens) 6480464 bisphenol S results in decreased methylation of IGSF9B gene CTD PMID:31601247 Igsf9b Rat aflatoxin B1 increases methylation ISO IGSF9B (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of IGSF9B gene and Aflatoxin B1 results in increased methylation of IGSF9B intron CTD PMID:27153756 and PMID:30157460 Igsf9b Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of IGSF9B mRNA CTD PMID:35163327 Igsf9b Rat antirheumatic drug increases expression ISO IGSF9B (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of IGSF9B mRNA CTD PMID:24449571 Igsf9b Rat arsane affects methylation ISO IGSF9B (Homo sapiens) 6480464 Arsenic affects the methylation of IGSF9B gene CTD PMID:25304211 Igsf9b Rat arsenic atom affects methylation ISO IGSF9B (Homo sapiens) 6480464 Arsenic affects the methylation of IGSF9B gene CTD PMID:25304211 Igsf9b Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of IGSF9B gene CTD PMID:35440735 Igsf9b Rat benzo[a]pyrene affects methylation ISO IGSF9B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IGSF9B 3' UTR and Benzo(a)pyrene affects the methylation of IGSF9B promoter CTD PMID:27901495 Igsf9b Rat benzo[a]pyrene increases methylation ISO IGSF9B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of IGSF9B exon CTD PMID:27901495 Igsf9b Rat benzo[e]pyrene increases methylation ISO IGSF9B (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of IGSF9B intron CTD PMID:30157460 Igsf9b Rat bis(2-ethylhexyl) phthalate multiple interactions ISO IGSF9B (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of IGSF9B gene CTD PMID:33872906 Igsf9b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IGSF9B mRNA CTD PMID:29097150 Igsf9b Rat bisphenol A increases expression ISO Igsf9b (Mus musculus) 6480464 bisphenol A results in increased expression of IGSF9B mRNA CTD PMID:29165653 Igsf9b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of IGSF9B mRNA CTD PMID:30816183 Igsf9b Rat cadmium dichloride increases expression ISO IGSF9B (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of IGSF9B mRNA CTD PMID:38568856 Igsf9b Rat carbamazepine affects expression ISO IGSF9B (Homo sapiens) 6480464 Carbamazepine affects the expression of IGSF9B mRNA CTD PMID:25979313 Igsf9b Rat cisplatin increases expression ISO IGSF9B (Homo sapiens) 6480464 Cisplatin results in increased expression of IGSF9B mRNA CTD PMID:27392435 Igsf9b Rat cisplatin multiple interactions ISO IGSF9B (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of IGSF9B mRNA CTD PMID:27392435 Igsf9b Rat clobetasol decreases expression ISO Igsf9b (Mus musculus) 6480464 Clobetasol results in decreased expression of IGSF9B mRNA CTD PMID:27462272 Igsf9b Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of IGSF9B mRNA CTD PMID:27523638 Igsf9b Rat Dibutyl phosphate affects expression ISO IGSF9B (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of IGSF9B mRNA CTD PMID:37042841 Igsf9b Rat doxorubicin decreases expression ISO IGSF9B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of IGSF9B mRNA CTD PMID:29803840 Igsf9b Rat esketamine increases expression ISO IGSF9B (Homo sapiens) 6480464 Esketamine results in increased expression of IGSF9B mRNA CTD PMID:38219984 Igsf9b Rat ethanol increases expression ISO Igsf9b (Mus musculus) 6480464 Ethanol results in increased expression of IGSF9B mRNA CTD PMID:30319688 Igsf9b Rat ethanol affects expression ISO Igsf9b (Mus musculus) 6480464 Ethanol affects the expression of IGSF9B mRNA CTD PMID:30319688 Igsf9b Rat folic acid decreases expression ISO Igsf9b (Mus musculus) 6480464 Folic Acid results in decreased expression of IGSF9B mRNA CTD PMID:25629700 Igsf9b Rat FR900359 increases phosphorylation ISO IGSF9B (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of IGSF9B protein CTD PMID:37730182 Igsf9b Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of IGSF9B mRNA CTD PMID:33387578 Igsf9b Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of IGSF9B mRNA CTD PMID:24915197 Igsf9b Rat lead(0) affects expression ISO IGSF9B (Homo sapiens) 6480464 Lead affects the expression of IGSF9B mRNA CTD PMID:28903495 Igsf9b Rat methapyrilene increases methylation ISO IGSF9B (Homo sapiens) 6480464 Methapyrilene results in increased methylation of IGSF9B intron CTD PMID:30157460 Igsf9b Rat mono(2-ethylhexyl) phthalate multiple interactions ISO IGSF9B (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of IGSF9B gene CTD PMID:33872906 Igsf9b Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of IGSF9B gene CTD PMID:33148267 Igsf9b Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of IGSF9B mRNA CTD PMID:33484710 Igsf9b Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of IGSF9B mRNA CTD PMID:33387578 Igsf9b Rat PCB138 multiple interactions ISO Igsf9b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Igsf9b Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of IGSF9B mRNA CTD PMID:35163327 Igsf9b Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of IGSF9B gene CTD PMID:33148267 Igsf9b Rat propofol decreases expression ISO IGSF9B (Homo sapiens) 6480464 Propofol results in decreased expression of IGSF9B mRNA CTD PMID:35238236 Igsf9b Rat silicon dioxide increases expression ISO IGSF9B (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of IGSF9B mRNA CTD PMID:23806026 Igsf9b Rat sodium arsenite affects methylation ISO IGSF9B (Homo sapiens) 6480464 sodium arsenite affects the methylation of IGSF9B gene CTD PMID:28589171 Igsf9b Rat sunitinib decreases expression ISO IGSF9B (Homo sapiens) 6480464 Sunitinib results in decreased expression of IGSF9B mRNA CTD PMID:31533062 Igsf9b Rat titanium dioxide affects methylation ISO Igsf9b (Mus musculus) 6480464 titanium dioxide affects the methylation of IGSF9B gene CTD PMID:35295148 Igsf9b Rat triphenyl phosphate affects expression ISO IGSF9B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of IGSF9B mRNA CTD PMID:37042841 Igsf9b Rat triptonide affects expression ISO Igsf9b (Mus musculus) 6480464 triptonide affects the expression of IGSF9B mRNA CTD PMID:33045310 Igsf9b Rat valproic acid increases methylation ISO IGSF9B (Homo sapiens) 6480464 Valproic Acid results in increased methylation of IGSF9B gene CTD PMID:29154799 Igsf9b Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of IGSF9B mRNA CTD PMID:29427782 Igsf9b Rat valproic acid affects expression ISO IGSF9B (Homo sapiens) 6480464 Valproic Acid affects the expression of IGSF9B mRNA CTD PMID:25979313
17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbamazepine (ISO) cisplatin (ISO) clobetasol (ISO) Cuprizon (EXP) Dibutyl phosphate (ISO) doxorubicin (ISO) esketamine (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) glycidol (EXP) lead(0) (ISO) methapyrilene (ISO) mono(2-ethylhexyl) phthalate (ISO) N,N-diethyl-m-toluamide (EXP) nitrofen (EXP) paracetamol (EXP) PCB138 (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) propofol (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (EXP,ISO)
Igsf9b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 33,971,779 - 34,027,390 (+) NCBI GRCr8 mRatBN7.2 8 25,712,644 - 25,769,481 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 25,712,644 - 25,758,554 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 29,754,600 - 29,800,497 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 28,048,896 - 28,094,798 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 25,928,882 - 25,974,781 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 28,352,497 - 28,398,659 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 28,352,772 - 28,387,383 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 28,371,484 - 28,417,964 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 26,905,723 - 26,941,081 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 27,199,908 - 27,245,801 (+) NCBI Celera Cytogenetic Map 8 q13 NCBI
IGSF9B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 133,896,438 - 133,956,968 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 133,896,438 - 133,956,968 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 133,766,333 - 133,826,863 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 133,290,395 - 133,332,090 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 130,958,989 - 131,000,543 (-) NCBI Celera Cytogenetic Map 11 q25 NCBI HuRef 11 129,733,097 - 129,781,186 (-) NCBI HuRef CHM1_1 11 133,666,445 - 133,714,597 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 133,938,732 - 133,999,751 (-) NCBI T2T-CHM13v2.0
Igsf9b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 27,210,400 - 27,268,845 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 27,210,500 - 27,268,842 (+) Ensembl GRCm39 Ensembl GRCm38 9 27,299,104 - 27,357,549 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 27,299,204 - 27,357,546 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 27,106,813 - 27,142,348 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 27,048,674 - 27,079,581 (+) NCBI MGSCv36 mm8 Celera 9 24,556,035 - 24,591,567 (+) NCBI Celera Cytogenetic Map 9 A4 NCBI cM Map 9 12.69 NCBI
Igsf9b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 34,724,220 - 34,767,970 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 34,712,556 - 34,828,013 (-) NCBI ChiLan1.0 ChiLan1.0
IGSF9B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 134,604,031 - 134,673,944 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 135,710,087 - 135,778,760 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 128,734,144 - 128,802,383 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 132,615,398 - 132,664,817 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 132,615,398 - 132,664,811 (-) Ensembl panpan1.1 panPan2
IGSF9B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 1,273,897 - 1,330,449 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 1,273,444 - 1,320,283 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 1,393,068 - 1,449,478 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 1,229,631 - 1,282,799 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 1,229,490 - 1,275,977 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 1,262,743 - 1,319,089 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 1,263,137 - 1,309,321 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 1,300,951 - 1,357,368 (+) NCBI UU_Cfam_GSD_1.0
Igsf9b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 115,640,774 - 115,700,847 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936684 1,902,077 - 1,992,890 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936684 1,902,111 - 1,956,106 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IGSF9B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 60,478,029 - 60,521,465 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 60,467,321 - 60,521,463 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 67,034,855 - 67,060,060 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IGSF9B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 124,969,228 - 125,021,334 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 124,974,027 - 125,021,200 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 1,024,070 - 1,075,009 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Igsf9b
.
Predicted Target Of
Count of predictions: 105 Count of miRNA genes: 85 Interacting mature miRNAs: 89 Transcripts: ENSRNOT00000012391 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317882 Alcrsp24 Alcohol response QTL 24 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 8 1 25902202 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat
BE119595
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 25,713,336 - 25,713,490 (+) MAPPER mRatBN7.2 Rnor_6.0 8 28,353,191 - 28,353,344 NCBI Rnor6.0 Rnor_5.0 8 28,372,180 - 28,372,333 UniSTS Rnor5.0 RGSC_v3.4 8 26,906,368 - 26,906,521 UniSTS RGSC3.4 Celera 8 27,200,602 - 27,200,755 UniSTS RH 3.4 Map 8 221.6 UniSTS Cytogenetic Map 8 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
48
113
59
58
27
25
27
6
182
93
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012391 ⟹ ENSRNOP00000012391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 25,712,644 - 25,758,554 (+) Ensembl Rnor_6.0 Ensembl 8 28,352,772 - 28,387,383 (+) Ensembl
RefSeq Acc Id:
NM_001376950 ⟹ NP_001363879
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,779 - 34,017,680 (+) NCBI mRatBN7.2 8 25,712,644 - 25,758,554 (+) NCBI
RefSeq Acc Id:
XM_006242743 ⟹ XP_006242805
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,802 - 34,027,390 (+) NCBI mRatBN7.2 8 25,712,663 - 25,769,481 (+) NCBI Rnor_6.0 8 28,352,498 - 28,398,659 (+) NCBI Rnor_5.0 8 28,371,484 - 28,417,964 (+) NCBI
Sequence:
GCGGGCCACAGGACAAGCTCAGCTAGGCTTCACCGTGGACCTGGCTGCGCTCTGCCTCCGTTGGCAGTGCAGGTGCCGCTGCGCCGGGGCCCGGGAGGCTGCGCGCGCCGAGACGAGAGGAGCCAGGG
hide sequence
RefSeq Acc Id:
XM_017595986 ⟹ XP_017451475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,801 - 34,007,378 (+) NCBI mRatBN7.2 8 25,712,662 - 25,748,256 (+) NCBI Rnor_6.0 8 28,352,497 - 28,388,368 (+) NCBI
Sequence:
GGCGGGCCACAGGACAAGCTCAGCTAGGCTTCACCGTGGACCTGGCTGCGCTCTGCCTCCGTTG
hide sequence
RefSeq Acc Id:
XM_017595988 ⟹ XP_017451477
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,802 - 34,017,165 (+) NCBI mRatBN7.2 8 25,712,663 - 25,758,035 (+) NCBI Rnor_6.0 8 28,352,497 - 28,398,086 (+) NCBI
Sequence:
GGCGGGCCACAGGACAAGCTCAGCTAGGCTTCACCGTGGACCTGGCTGCGCTCTGCCTCCGTTGGCAGTGCAGGTGCCGCTGCGCCGGGGCCCGGGAGGCTGCGCGCGCCGAGACGAGAGGAGCCAGG
hide sequence
RefSeq Acc Id:
XM_017595989 ⟹ XP_017451478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,802 - 34,017,165 (+) NCBI mRatBN7.2 8 25,712,663 - 25,758,035 (+) NCBI Rnor_6.0 8 28,352,497 - 28,398,086 (+) NCBI
Sequence:
GGCGGGCCACAGGACAAGCTCAGCTAGGCTTCACCGTGGACCTGGCTGCGCTCTGCCTCCGTTG
hide sequence
RefSeq Acc Id:
XM_235959 ⟹ XP_235959
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,803 - 34,027,390 (+) NCBI mRatBN7.2 8 25,712,664 - 25,769,481 (+) NCBI Rnor_6.0 8 28,352,498 - 28,398,659 (+) NCBI Rnor_5.0 8 28,371,484 - 28,417,964 (+) NCBI RGSC_v3.4 8 26,905,723 - 26,941,081 (+) RGD
Sequence:
GCGGGCCACAGGACAAGCTCAGCTAGGCTTCACCGTGGACCTGGCTGCGCTCTGCCTCCGTTGGCAGTGCAGGTGCCGCTGCGCCGGGGCCCGGGAGGCTGCGCGCGCCGAGACGAGAGGAGCCAGGG
hide sequence
RefSeq Acc Id:
XR_005487809
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,802 - 34,017,043 (+) NCBI mRatBN7.2 8 25,712,663 - 25,757,921 (+) NCBI
RefSeq Acc Id:
XR_005487810
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,971,802 - 34,017,043 (+) NCBI mRatBN7.2 8 25,712,663 - 25,757,921 (+) NCBI
RefSeq Acc Id:
XP_235959 ⟸ XM_235959
- Peptide Label:
isoform X1
- UniProtKB:
D3ZB51 (UniProtKB/Swiss-Prot)
- Sequence:
MIWYVATLIASVISTRGLVAQVAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQQYDTFHNG
hide sequence
RefSeq Acc Id:
XP_006242805 ⟸ XM_006242743
- Peptide Label:
isoform X4
- UniProtKB:
D3ZB51 (UniProtKB/Swiss-Prot)
- Sequence:
MIWYVATLIASVISTRGLVAQVAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFK
hide sequence
RefSeq Acc Id:
XP_017451477 ⟸ XM_017595988
- Peptide Label:
isoform X3
- UniProtKB:
D3ZB51 (UniProtKB/Swiss-Prot)
- Sequence:
MIWYVATLIASVISTRGLVAQVAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFK
hide sequence
RefSeq Acc Id:
XP_017451478 ⟸ XM_017595989
- Peptide Label:
isoform X5
- UniProtKB:
D3ZB51 (UniProtKB/Swiss-Prot)
- Sequence:
MIWYVATLIASVISTRGLVAQVAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFK
hide sequence
RefSeq Acc Id:
XP_017451475 ⟸ XM_017595986
- Peptide Label:
isoform X2
- UniProtKB:
D3ZB51 (UniProtKB/Swiss-Prot)
- Sequence:
MIWYVATLIASVISTRGLVAQVAHGLREEPEFVTARAGEGVVLRCDVIHPVTGQPPPYVVEWFK
hide sequence
Ensembl Acc Id:
ENSRNOP00000012391 ⟸ ENSRNOT00000012391
RefSeq Acc Id:
NP_001363879 ⟸ NM_001376950
- Peptide Label:
precursor
- UniProtKB:
D3ZB51 (UniProtKB/Swiss-Prot), A0A8L2Q5X0 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Igsf9b
immunoglobulin superfamily, member 9B
Igsf9b_predicted
immunoglobulin superfamily, member 9B (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Igsf9b_predicted
immunoglobulin superfamily, member 9B (predicted)
RGD1564717_predicted
similar to immunoglobulin superfamily, member 9 (predicted)
Symbol and Name updated
1299863 APPROVED
2006-03-07
RGD1564717_predicted
similar to immunoglobulin superfamily, member 9 (predicted)
LOC315510
similar to immunoglobulin superfamily, member 9
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC315510
similar to immunoglobulin superfamily, member 9
Symbol and Name status set to provisional
70820 PROVISIONAL
