Symbol:
Smcr8
Name:
SMCR8-C9orf72 complex subunit
RGD ID:
1564621
Description:
Predicted to enable GTPase activator activity; protein kinase binding activity; and protein kinase inhibitor activity. Predicted to contribute to guanyl-nucleotide exchange factor activity. Predicted to be involved in negative regulation of gene expression; regulation of TOR signaling; and regulation of macroautophagy. Predicted to be located in several cellular components, including nucleoplasm; postsynapse; and presynapse. Predicted to be part of Atg1/ULK1 kinase complex and guanyl-nucleotide exchange factor complex. Orthologous to human SMCR8 (SMCR8-C9orf72 complex subunit); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.
Type:
protein-coding
RefSeq Status:
INFERRED
Previously known as:
guanine nucleotide exchange protein SMCR8; LOC497918; RGD1564621; similar to Smcr8 protein; Smith-Magenis syndrome chromosome region, candidate 8; Smith-Magenis syndrome chromosome region, candidate 8 homolog; Smith-Magenis syndrome chromosome region, candidate 8 homolog (human)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SMCR8 (SMCR8-C9orf72 complex subunit) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Smcr8 (Smith-Magenis syndrome chromosome region, candidate 8 homolog (human)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Smcr8 (SMCR8-C9orf72 complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SMCR8 (SMCR8-C9orf72 complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SMCR8 (SMCR8-C9orf72 complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Smcr8 (SMCR8-C9orf72 complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SMCR8 (SMCR8-C9orf72 complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SMCR8 (SMCR8-C9orf72 complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Smcr8 (SMCR8-C9orf72 complex subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SMCR8 (SMCR8-C9orf72 complex subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Smcr8 (Smith-Magenis syndrome chromosome region, candidate 8 homolog (human))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
smcr8a (Smith-Magenis syndrome chromosome region, candidate 8a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
smcr-8
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
smcr8
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 45,957,146 - 45,968,388 (+) NCBI GRCr8 mRatBN7.2 10 45,457,962 - 45,465,101 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 45,457,605 - 45,468,876 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 50,159,207 - 50,166,360 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 49,649,603 - 49,656,756 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 45,153,192 - 45,160,345 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,019,326 - 47,026,465 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,018,974 - 47,026,465 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 46,791,502 - 46,798,641 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 46,924,224 - 46,931,363 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 44,712,528 - 44,719,666 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Smcr8 Rat 1,2-dichloroethane increases expression ISO Smcr8 (Mus musculus) 6480464 ethylene dichloride results in increased expression of SMCR8 mRNA CTD PMID:28960355 Smcr8 Rat 1,2-dimethylhydrazine decreases expression ISO Smcr8 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SMCR8 mRNA CTD PMID:22206623 Smcr8 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SMCR8 mRNA CTD PMID:29097150 Smcr8 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Smcr8 (Mus musculus) 6480464 2 more ... CTD PMID:24680724 Smcr8 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SMCR8 mRNA CTD PMID:32109520 Smcr8 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SMCR8 mRNA CTD PMID:33387578 Smcr8 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SMCR8 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SMCR8 mRNA CTD PMID:28628672 Smcr8 Rat 4,4'-sulfonyldiphenol multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SMCR8 mRNA CTD PMID:28628672 Smcr8 Rat 4,4'-sulfonyldiphenol affects expression ISO Smcr8 (Mus musculus) 6480464 bisphenol S affects the expression of SMCR8 mRNA CTD PMID:39298647 Smcr8 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of SMCR8 mRNA CTD PMID:31881176 Smcr8 Rat acrylamide increases expression ISO SMCR8 (Homo sapiens) 6480464 Acrylamide results in increased expression of SMCR8 mRNA CTD PMID:32763439 Smcr8 Rat aflatoxin B1 increases expression ISO Smcr8 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of SMCR8 mRNA CTD PMID:19770486 Smcr8 Rat all-trans-retinoic acid increases expression ISO SMCR8 (Homo sapiens) 6480464 Tretinoin results in increased expression of SMCR8 mRNA CTD PMID:33167477 Smcr8 Rat antirheumatic drug decreases expression ISO SMCR8 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SMCR8 mRNA CTD PMID:24449571 Smcr8 Rat arsane affects methylation ISO SMCR8 (Homo sapiens) 6480464 Arsenic affects the methylation of SMCR8 gene CTD PMID:25304211 Smcr8 Rat arsane multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SMCR8 mRNA CTD PMID:39836092 Smcr8 Rat arsenic atom affects methylation ISO SMCR8 (Homo sapiens) 6480464 Arsenic affects the methylation of SMCR8 gene CTD PMID:25304211 Smcr8 Rat arsenic atom multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SMCR8 mRNA CTD PMID:39836092 Smcr8 Rat benzo[a]pyrene increases methylation ISO SMCR8 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SMCR8 5' UTR CTD PMID:27901495 Smcr8 Rat benzo[a]pyrene affects methylation ISO SMCR8 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SMCR8 intron CTD PMID:30157460 Smcr8 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SMCR8 mRNA CTD PMID:29097150 and PMID:32145629 Smcr8 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SMCR8 mRNA CTD PMID:34947998 Smcr8 Rat bisphenol F multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SMCR8 mRNA CTD PMID:28628672 Smcr8 Rat cadmium atom increases expression ISO SMCR8 (Homo sapiens) 6480464 Cadmium results in increased expression of SMCR8 mRNA CTD PMID:24376830 Smcr8 Rat cadmium atom decreases expression ISO SMCR8 (Homo sapiens) 6480464 Cadmium results in decreased expression of SMCR8 mRNA CTD PMID:23369406 Smcr8 Rat caffeine affects phosphorylation ISO SMCR8 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of SMCR8 protein CTD PMID:35688186 Smcr8 Rat chlorpyrifos decreases expression ISO Smcr8 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of SMCR8 mRNA CTD PMID:37019170 Smcr8 Rat cyclosporin A increases expression ISO SMCR8 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SMCR8 mRNA CTD PMID:20106945 Smcr8 Rat cyclosporin A increases methylation ISO SMCR8 (Homo sapiens) 6480464 Cyclosporine results in increased methylation of SMCR8 promoter CTD PMID:27989131 Smcr8 Rat dexamethasone multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SMCR8 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SMCR8 mRNA CTD PMID:28628672 Smcr8 Rat Dibutyl phosphate affects expression ISO SMCR8 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SMCR8 mRNA CTD PMID:37042841 Smcr8 Rat dicrotophos increases expression ISO SMCR8 (Homo sapiens) 6480464 dicrotophos results in increased expression of SMCR8 mRNA CTD PMID:28302478 Smcr8 Rat dorsomorphin multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMCR8 mRNA CTD PMID:27188386 Smcr8 Rat doxorubicin decreases expression ISO SMCR8 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SMCR8 mRNA CTD PMID:29803840 Smcr8 Rat ethyl methanesulfonate increases expression ISO SMCR8 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of SMCR8 mRNA CTD PMID:23649840 Smcr8 Rat formaldehyde increases expression ISO SMCR8 (Homo sapiens) 6480464 Formaldehyde results in increased expression of SMCR8 mRNA CTD PMID:23649840 Smcr8 Rat FR900359 affects phosphorylation ISO SMCR8 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SMCR8 protein CTD PMID:37730182 Smcr8 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SMCR8 mRNA CTD PMID:33387578 Smcr8 Rat indometacin multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SMCR8 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SMCR8 mRNA CTD PMID:28628672 Smcr8 Rat lead diacetate multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of SMCR8 mRNA CTD PMID:22839698 Smcr8 Rat manganese atom multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SMCR8 mRNA CTD PMID:39836092 Smcr8 Rat manganese(0) multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SMCR8 mRNA CTD PMID:39836092 Smcr8 Rat manganese(II) chloride multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SMCR8 mRNA CTD PMID:39836092 Smcr8 Rat methotrexate decreases expression ISO SMCR8 (Homo sapiens) 6480464 Methotrexate results in decreased expression of SMCR8 mRNA CTD PMID:24449571 Smcr8 Rat methyl methanesulfonate increases expression ISO SMCR8 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of SMCR8 mRNA CTD PMID:23649840 Smcr8 Rat methylmercury chloride increases expression ISO SMCR8 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SMCR8 mRNA CTD PMID:23179753 and PMID:26272509 Smcr8 Rat methylmercury chloride decreases expression ISO SMCR8 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SMCR8 mRNA CTD PMID:28001369 Smcr8 Rat methylmercury chloride multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMCR8 mRNA CTD PMID:27188386 Smcr8 Rat methylparaben increases expression ISO SMCR8 (Homo sapiens) 6480464 methylparaben results in increased expression of SMCR8 mRNA CTD PMID:31745603 Smcr8 Rat N(4)-hydroxycytidine decreases expression ISO Smcr8 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of SMCR8 mRNA CTD PMID:37748715 Smcr8 Rat paracetamol increases expression ISO SMCR8 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SMCR8 mRNA CTD PMID:29067470 Smcr8 Rat SB 431542 multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SMCR8 mRNA CTD PMID:27188386 Smcr8 Rat sodium arsenite increases expression ISO SMCR8 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SMCR8 mRNA CTD PMID:38568856 Smcr8 Rat sodium arsenite multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SMCR8 mRNA CTD PMID:39836092 Smcr8 Rat sunitinib increases expression ISO SMCR8 (Homo sapiens) 6480464 Sunitinib results in increased expression of SMCR8 mRNA CTD PMID:31533062 Smcr8 Rat titanium dioxide decreases expression ISO Smcr8 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SMCR8 mRNA CTD PMID:35295148 Smcr8 Rat titanium dioxide decreases methylation ISO Smcr8 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SMCR8 gene CTD PMID:35295148 Smcr8 Rat tungsten decreases expression ISO Smcr8 (Mus musculus) 6480464 Tungsten results in decreased expression of SMCR8 mRNA CTD PMID:30912803 Smcr8 Rat urethane decreases expression ISO SMCR8 (Homo sapiens) 6480464 Urethane results in decreased expression of SMCR8 mRNA CTD PMID:28818685 Smcr8 Rat valproic acid affects expression ISO Smcr8 (Mus musculus) 6480464 Valproic Acid affects the expression of SMCR8 mRNA CTD PMID:17292431 Smcr8 Rat valproic acid affects expression ISO SMCR8 (Homo sapiens) 6480464 Valproic Acid affects the expression of SMCR8 mRNA CTD PMID:25979313 Smcr8 Rat zinc protoporphyrin multiple interactions ISO SMCR8 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of SMCR8 mRNA CTD PMID:22839698
Smcr8 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 45,957,146 - 45,968,388 (+) NCBI GRCr8 mRatBN7.2 10 45,457,962 - 45,465,101 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 45,457,605 - 45,468,876 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 50,159,207 - 50,166,360 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 49,649,603 - 49,656,756 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 45,153,192 - 45,160,345 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,019,326 - 47,026,465 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,018,974 - 47,026,465 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 46,791,502 - 46,798,641 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 46,924,224 - 46,931,363 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 44,712,528 - 44,719,666 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
SMCR8 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 18,315,293 - 18,328,056 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 18,315,293 - 18,328,056 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 18,218,607 - 18,231,370 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 18,159,319 - 18,172,095 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 18,159,440 - 18,167,109 NCBI Celera 17 19,159,665 - 19,172,441 (+) NCBI Celera Cytogenetic Map 17 p11.2 NCBI HuRef 17 17,972,126 - 17,984,902 (+) NCBI HuRef CHM1_1 17 18,227,353 - 18,240,129 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 18,262,099 - 18,274,862 (+) NCBI T2T-CHM13v2.0
Smcr8 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 60,668,351 - 60,679,113 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 60,668,350 - 60,679,113 (+) Ensembl GRCm39 Ensembl GRCm38 11 60,777,525 - 60,788,287 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 60,777,524 - 60,788,287 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 60,591,027 - 60,601,789 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 60,593,737 - 60,597,262 (+) NCBI MGSCv36 mm8 MGSCv36 11 61,208,627 - 61,212,152 (+) NCBI MGSCv36 mm8 Cytogenetic Map 11 B2 NCBI cM Map 11 37.83 NCBI
Smcr8 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 11,002,174 - 11,015,123 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 11,002,174 - 11,015,123 (-) NCBI ChiLan1.0 ChiLan1.0
SMCR8 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 52,939,905 - 52,952,684 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 57,651,042 - 57,663,823 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 32,858,205 - 32,871,132 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 37,884,037 - 37,897,031 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 37,884,037 - 37,896,972 (-) Ensembl panpan1.1 panPan2
SMCR8 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ROS_Cfam_1.0 5 41,356,732 - 41,369,920 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 41,361,422 - 41,369,287 (-) Ensembl ROS_Cfam_1.0 Ensembl
Smcr8 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 61,018,506 - 61,028,302 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936741 1,838,834 - 1,844,459 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936741 1,838,974 - 1,848,742 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SMCR8
SMCR8 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 17,358,952 - 17,367,323 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 17,359,577 - 17,366,851 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 3,537,962 - 3,546,697 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Smcr8
.
Predicted Target Of
Count of predictions: 205 Count of miRNA genes: 146 Interacting mature miRNAs: 161 Transcripts: ENSRNOT00000006984 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61332 Eau3 Experimental allergic uveoretinitis QTL 3 0.004 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 34490559 45579777 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 11528628 Bss116 Bone structure and strength QTL 116 6.46 4e-07 femur morphology trait (VT:0000559) femur length (CMO:0000442) 10 44179770 45632973 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006984 ⟹ ENSRNOP00000006984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 45,457,605 - 45,468,876 (+) Ensembl Rnor_6.0 Ensembl 10 47,019,326 - 47,026,465 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079375 ⟹ ENSRNOP00000069945
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 47,018,974 - 47,026,319 (+) Ensembl
RefSeq Acc Id:
NM_001191919 ⟹ NP_001178848
RefSeq Status:
INFERRED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 45,957,473 - 45,964,612 (+) NCBI mRatBN7.2 10 45,457,962 - 45,465,101 (+) NCBI Rnor_6.0 10 47,019,326 - 47,026,465 (+) NCBI Rnor_5.0 10 46,791,502 - 46,798,641 (+) NCBI Celera 10 44,712,528 - 44,719,666 (+) NCBI
Sequence:
CCCGGAAGTACAAAGAAGGCCGCAAGAACTTCGCTTTCTCATCCAGAGGCCTGACTTCCCTGCCGAGTAACCCTGCATTATTTCCCATTTCCTCTCAATGTGCTCTCCATATTTCAGGAAATATGATC
hide sequence
RefSeq Acc Id:
XM_063269615 ⟹ XP_063125685
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 45,957,146 - 45,968,388 (+) NCBI
RefSeq Acc Id:
NP_001178848 ⟸ NM_001191919
- UniProtKB:
D3ZJR6 (UniProtKB/TrEMBL)
- Sequence:
MISAPDVVAFTKEDEYEEEPYNEPALPEEYSVPLFPYASQGANPWSKLSGAKFSRDFILISEFSEQVGPQPLLTIPNDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGSAYPKLNFVEDSKVVLGDS
hide sequence
Ensembl Acc Id:
ENSRNOP00000069945 ⟸ ENSRNOT00000079375
Ensembl Acc Id:
ENSRNOP00000006984 ⟸ ENSRNOT00000006984
RefSeq Acc Id:
XP_063125685 ⟸ XM_063269615
- Peptide Label:
isoform X1
- UniProtKB:
D3ZJR6 (UniProtKB/TrEMBL)
RGD ID: 13697254 Promoter ID: EPDNEW_R7777 Type: multiple initiation site Name: Smcr8_1 Description: Smith-Magenis syndrome chromosome region, candidate 8 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 47,018,968 - 47,019,028 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-04-02
Smcr8
SMCR8-C9orf72 complex subunit
Smcr8
Smith-Magenis syndrome chromosome region, candidate 8
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-03-01
Smcr8
Smith-Magenis syndrome chromosome region, candidate 8
Smcr8
Smith-Magenis syndrome chromosome region, candidate 8 homolog (human)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Smcr8
Smith-Magenis syndrome chromosome region, candidate 8 homolog (human)
RGD1564621_predicted
similar to Smcr8 protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1564621_predicted
similar to Smcr8 protein (predicted)
LOC497918
similar to Smcr8 protein
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC497918
similar to Smcr8 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
