Advanced Search (OLGA)

Gene: Chmp4c (charged multivesicular body protein 4C) Rattus norvegicus

Analyze

Symbol:

Chmp4c

Name:

charged multivesicular body protein 4C

RGD ID:

1564543

Description:

Predicted to enable protein homodimerization activity. Predicted to be involved in several processes, including proteolysis involved in protein catabolic process; regulation of cell cycle process; and vacuolar transport. Predicted to be located in several cellular components, including Flemming body; bounding membrane of organelle; and kinetochore microtubule. Predicted to be part of ESCRT III complex and nuclear pore. Predicted to be active in cytoplasmic side of plasma membrane; multivesicular body; and nuclear envelope. Orthologous to human CHMP4C (charged multivesicular body protein 4C); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

chromatin modifying protein 4C; chromatin-modifying protein 4c; MGC108776; Snf7 homologue associated with Alix 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CHMP4C (charged multivesicular body protein 4C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Chmp4c (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Chmp4c (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CHMP4C (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CHMP4C (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Chmp4c (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CHMP4C (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CHMP4C (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Chmp4c (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Chmp4c (charged multivesicular body protein 4C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MPV17L2 (MPV17 mitochondrial inner membrane protein like 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CHMP4C (charged multivesicular body protein 4C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Chmp4c (charged multivesicular body protein 4C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	chmp4c (charged multivesicular body protein 4C)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SNF7	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	SNF7	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	shrb	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vps-32.1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	vps-32.1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	chmp4c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	chmp4c	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	93,299,152 - 93,336,075 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	93,299,157 - 93,360,850 (-)	Ensembl				GRCr8
mRatBN7.2	2	91,391,729 - 91,428,652 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	91,388,530 - 91,428,668 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	97,882,208 - 97,919,268 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,003,194 - 96,040,254 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	91,060,064 - 91,097,120 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	92,697,806 - 92,734,867 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	92,760,724 - 92,797,787 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	92,618,005 - 92,655,066 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	92,418,002 - 92,455,061 (-)	NCBI		F344_StmMcwi
Rnor_6.0	2	93,574,554 - 93,641,497 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	93,574,559 - 93,641,497 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	113,397,120 - 113,397,419 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	113,334,155 - 113,340,595 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	93,330,478 - 93,382,152 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	86,994,242 - 87,031,805 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Ovarian Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

cadmium dichloride (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

cyclosporin A (ISO)

DDE (ISO)

decabromodiphenyl ether (EXP)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glafenine (EXP)

glycidol (EXP)

glyphosate (EXP)

indole-3-methanol (EXP)

ivermectin (ISO)

mercury dibromide (ISO)

methoxychlor (EXP)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (ISO)

nefazodone (EXP)

nitrofen (EXP)

orphenadrine (EXP)

paracetamol (EXP)

paraquat (EXP)

PCB138 (EXP)

permethrin (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

rac-lactic acid (ISO)

rotenone (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

thiram (ISO)

tributylstannane (ISO)

triclosan (ISO)

triphenyl phosphate (EXP)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

autophagosome maturation (ISO)

autophagy (ISO)

late endosome to lysosome transport (ISO)

late endosome to vacuole transport via multivesicular body sorting pathway (IBA)

midbody abscission (ISO,ISS)

mitotic cytokinesis checkpoint signaling (ISO,ISS)

mitotic metaphase chromosome alignment (ISO)

multivesicular body sorting pathway (ISO)

negative regulation of cytokinesis (ISO,ISS)

nuclear membrane reassembly (IBA,ISO)

nucleus organization (ISO)

plasma membrane repair (ISO)

protein transport (IEA)

regulation of centrosome duplication (ISO)

regulation of mitotic spindle assembly (ISO)

ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway (ISO)

ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway (ISO)

vacuolar transport (IEA)

vesicle budding from membrane (IBA)

viral budding from plasma membrane (ISO)

viral budding via host ESCRT complex (ISO)

Cellular Component

amphisome membrane (ISO)

autophagosome membrane (ISO)

cytoplasmic side of plasma membrane (IBA)

cytosol (IEA)

endosome membrane (IEA)

ESCRT III complex (IBA)

Flemming body (IEA,ISO)

kinetochore (ISO)

kinetochore microtubule (ISO)

late endosome membrane (IEA)

lysosomal membrane (ISO)

midbody (IEA,ISO)

multivesicular body (IBA)

multivesicular body membrane (ISO)

nuclear envelope (IBA)

plasma membrane (ISO)

Molecular Function

protein binding (ISO)

protein homodimerization activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14505570	PMID:14519844	PMID:15489334	PMID:20616062	PMID:22422861	PMID:22547407	PMID:22724069	PMID:23376485	PMID:24814515	PMID:37846580

Genomics

Comparative Map Data

Chmp4c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	93,299,152 - 93,336,075 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	93,299,157 - 93,360,850 (-)	Ensembl				GRCr8
mRatBN7.2	2	91,391,729 - 91,428,652 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	91,388,530 - 91,428,668 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	97,882,208 - 97,919,268 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	96,003,194 - 96,040,254 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	91,060,064 - 91,097,120 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	2	92,697,806 - 92,734,867 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	2	92,760,724 - 92,797,787 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	2	92,618,005 - 92,655,066 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	2	92,418,002 - 92,455,061 (-)	NCBI		F344_StmMcwi
Rnor_6.0	2	93,574,554 - 93,641,497 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	93,574,559 - 93,641,497 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	113,397,120 - 113,397,419 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	2	113,334,155 - 113,340,595 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	93,330,478 - 93,382,152 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	86,994,242 - 87,031,805 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

CHMP4C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	81,732,448 - 81,759,515 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	81,732,448 - 81,759,515 (+)	Ensembl			hg38	GRCh38
GRCh37	8	82,644,683 - 82,671,750 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	82,807,243 - 82,834,305 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	8	78,649,178 - 78,676,231 (+)	NCBI		Celera
Cytogenetic Map	8	q21.13	NCBI
HuRef	8	78,134,628 - 78,161,684 (+)	NCBI		HuRef
CHM1_1	8	82,696,279 - 82,723,341 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	82,164,151 - 82,191,202 (+)	NCBI		T2T-CHM13v2.0

Chmp4c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	10,432,033 - 10,456,065 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	10,431,967 - 10,493,916 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	10,366,973 - 10,391,005 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	10,366,907 - 10,428,856 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	10,366,973 - 10,391,005 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	10,349,505 - 10,373,537 (+)	NCBI		MGSCv36	mm8
MGSCv36	3	10,412,264 - 10,436,293 (+)	NCBI		MGSCv36	mm8
Celera	3	10,401,114 - 10,425,079 (+)	NCBI		Celera
Cytogenetic Map	3	A1	NCBI
cM Map	3	2.63	NCBI

Chmp4c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	96,865 - 137,739 (+)	Ensembl
ChiLan1.0	NW_004955417	96,674 - 135,601 (+)	NCBI	ChiLan1.0	ChiLan1.0

CHMP4C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	97,473,405 - 97,500,701 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	73,102,765 - 73,130,044 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	78,259,783 - 78,286,807 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	79,879,823 - 79,906,859 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	79,879,716 - 79,906,852 (+)	Ensembl			panPan2	panpan1.1

CHMP4C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	28,839,459 - 28,865,793 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	28,839,516 - 28,865,023 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	29,120,369 - 29,146,705 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	28,973,519 - 28,999,876 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	28,973,553 - 28,999,871 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	29,042,865 - 29,069,392 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	29,056,789 - 29,083,112 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	29,413,985 - 29,440,300 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Chmp4c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	50,341,913 - 50,367,586 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936656	2,531,576 - 2,558,106 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936656	2,531,654 - 2,558,106 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CHMP4C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	54,859,930 - 54,895,192 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	54,860,481 - 54,895,229 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	60,005,464 - 60,014,021 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CHMP4C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	77,143,302 - 77,174,874 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	77,143,612 - 77,173,852 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	64,018,455 - 64,051,732 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Chmp4c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	9,739,651 - 9,769,615 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624744	9,735,585 - 9,769,635 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Chmp4c
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	144,415,334 - 144,442,628 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Chmp4c
226 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	586
Count of miRNA genes:	276
Interacting mature miRNAs:	358
Transcripts:	ENSRNOT00000013720
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	61556902	106556902	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	78269809	104744824	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	51266859	96266859	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Markers in Region

D2Got323

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	91,429,471 - 91,429,834 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	91,429,607 - 91,429,834 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	93,642,453 - 93,642,969	NCBI	Rnor6.0
Rnor_6.0	2	93,642,743 - 93,642,969	NCBI	Rnor6.0
Rnor_5.0	2	113,398,665 - 113,398,891	UniSTS	Rnor5.0
Rnor_5.0	2	113,398,375 - 113,398,891	UniSTS	Rnor5.0
RGSC_v3.4	2	93,383,108 - 93,383,334	UniSTS	RGSC3.4
Celera	2	87,032,761 - 87,032,987	UniSTS
Cytogenetic Map	2	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	135	91	90	59	48	59	6	328	151	14	109	94	92	31	3	3

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001017466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC092576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO383495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013720 ⟹ ENSRNOP00000013720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	93,299,157 - 93,336,075 (-)	Ensembl
mRatBN7.2 Ensembl	2	91,388,530 - 91,428,658 (-)	Ensembl
Rnor_6.0 Ensembl	2	93,574,559 - 93,641,497 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096114 ⟹ ENSRNOP00000086688

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	91,399,677 - 91,428,615 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112018 ⟹ ENSRNOP00000092489

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	91,398,859 - 91,428,668 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000157181 ⟹ ENSRNOP00000098677

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	93,299,157 - 93,360,850 (-)	Ensembl

RefSeq Acc Id:

NM_001017466 ⟹ NP_001017466

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	93,299,152 - 93,336,075 (-)	NCBI
mRatBN7.2	2	91,391,729 - 91,428,652 (-)	NCBI
Dahl_SR_JrHsd	2	92,697,806 - 92,734,867 (-)	NCBI
Lyon_Normotensive	2	92,760,724 - 92,797,787 (-)	NCBI
Lyon_Hypertensive	2	92,618,005 - 92,655,066 (-)	NCBI
F344_StmMcwi	2	92,418,002 - 92,455,061 (-)	NCBI
Rnor_6.0	2	93,574,554 - 93,641,497 (-)	NCBI
Rnor_5.0	2	113,334,155 - 113,340,595 (-)	NCBI
Rnor_5.0	2	113,397,120 - 113,397,419 (-)	NCBI
RGSC_v3.4	2	93,330,478 - 93,382,152 (-)	RGD
Celera	2	86,994,242 - 87,031,805 (-)	RGD

Sequence:

show sequence

GTGGGTGTCACCTGCCGAAACAACTTGTTGATTCCCAGGAGCTTTGTTGGCTCTGAGTGTGGCT
CACCTGTCTCGGGAGCGCTGGGACGCTCGCCCACCACTGCTCAGCCATGAGCAAGTTGGGCAAG
TTTTTCAAAGGGTCTCGCTCTTCTCGGGCCCGCGCGGCTCCCAGCGCTCAGGAAGCCCTGGCTC
GACTCCGGGAGACCGAGGAGATGATGGCCAAGAAGCAGGAGTACCTGGAGAACCGAATCCAGAG
GGAGCTTGCTCTAGCCAAGAAGCACGGCTCCCAGAACAAGCGAGCTGCCTTGCAGGCACTGAAA
AGAAAGAAGAGATTTGAGAAGCAGCTCACACAGATTGACGGCACCCTTTCCACCATTGAGTTCC
AGCGGGAGGCGCTAGAGAACTCACACACCAACACTGAGGTCTTACGGAACATGGGCTTCGCAGC
CAAGGCCATGAAAGCTGTTCATGAAAACATGGATCTCAACAAAATCGATGACTTGATGCAAGAC
ATCACAGAGCAGCAGGACATTGCCCAGGAAATCTCAGAAGCGTTTTCTCAAAGAGTTCAGTTTG
CTGATGGCTTCGATGAGGATGAGCTTCTGGCGGAGCTCGAGGAACTGGAGCAGGAAGAATTAAA
TAAGAAGATGACAAGCATGGAGCTCCCAAATGTGCCTTCCTCATCCCTCCCAGCACAGCCCAGC
AGGAAGGCCGGCGTGCCTTCCTCTGTGCACCGCTCTCGAGCAGCATCTTCCAGGAGGGCAGAGG
AAGATGATGACTTCAAGCAGCTGGCAGCCTGGGCCACTTAAGCTACAACGGAAAAAAAAATTGA
CACCTAAATTATTGAACTACACATAAGACGTAAATGCTTTGCGAAGCTTAGAAATTAGCAGAGA
CATGTTTTACATGGATTGTTGCCTTTTAAATAACAGTTAAGGTATAGTCAGGGTTGCAAAGGGG
CCCAGTATCATTGGAGGAGAGCTTTCCAGACTGCTGGACTCACGGAGCTGCTCTATTTACTACT
GTGTTTCTAGTCCTGGTATATAGTTGATTTTTTTTTTGTATGTATGTATTGAAAACAACTCTTC
TGACATTTAATACACATTCCAGTTTATAAGCCTTCCCGAGGAATACCTAGGATAACTGGGGGTG
CAGGGTTGGGGGATGTCTATGCAAATACAAGGCAGCTGTGTGCATCCTGGTCACCCACAGCAAA
AATAAATACGCTGCTAGAACAGACTTGTTCTAGTGAGTCTGTATAGTTTCAGTTGAGTTTCACA
GCTGAAAATCTTCAGGGAGCTTTACTTTAATTGACGTTTAGTACGCTGATTGAGCTTTGAGTGG
GGCAATGGAGGGATCTCCCCAAAAATCTGAAAGCAGTAACAGCTTAGTGTGCCGGGCAGGCGTC
TCCGGGCTGTGAAGCACCTGCTGAGTGGACACTCGCAGGCTGTTGCCAGCACCGTTCATTCTCT
GCTGTTTTGTGTTCTCTTGCCCTTTTAACAAGAACAAAACAAAACGAGATCCAAACATTTCACA
GCGTGCACTTTGTAAATATATTAAAATACTGGCAATTAAAAAATGTATCTCAAGTAAAAAAAAA
AAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063282036 ⟹ XP_063138106

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	93,299,152 - 93,306,333 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001017466	(Get FASTA)	NCBI Sequence Viewer
	XP_063138106	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH92576	(Get FASTA)	NCBI Sequence Viewer
	EDM00985	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013720
GenBank Protein	Q569C1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001017466 ⟸ NM_001017466

- UniProtKB:

Q569C1 (UniProtKB/Swiss-Prot), F1LPT7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSKLGKFFKGSRSSRARAAPSAQEALARLRETEEMMAKKQEYLENRIQRELALAKKHGSQNKRA
ALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKAVHENMDLNKI
DDLMQDITEQQDIAQEISEAFSQRVQFADGFDEDELLAELEELEQEELNKKMTSMELPNVPSSS
LPAQPSRKAGVPSSVHRSRAASSRRAEEDDDFKQLAAWAT

hide sequence

Ensembl Acc Id:

ENSRNOP00000013720 ⟸ ENSRNOT00000013720

Ensembl Acc Id:

ENSRNOP00000092489 ⟸ ENSRNOT00000112018

Ensembl Acc Id:

ENSRNOP00000086688 ⟸ ENSRNOT00000096114

RefSeq Acc Id:	XP_063138106 ⟸ XM_063282036
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000098677 ⟸ ENSRNOT00000157181

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q569C1-F1-model_v2	AlphaFold	Q569C1	1-232	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691232

Promoter ID:

EPDNEW_R1755

Type:

initiation region

Name:

Chmp4c_1

Description:

charged multivesicular body protein 4C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	93,641,481 - 93,641,541	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564543	AgrOrtholog
BioCyc Gene	G2FUF-53764	BioCyc
Ensembl Genes	ENSRNOG00000010238	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000013720	ENTREZGENE
Gene3D-CATH	6.10.250.1710	UniProtKB/Swiss-Prot
	ESAT-6-like	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7122321	IMAGE-MGC_LOAD
InterPro	Snf7_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:361916	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108776	IMAGE-MGC_LOAD
NCBI Gene	361916	ENTREZGENE
PANTHER	CHARGED MULTIVESICULAR BODY PROTEIN 4C	UniProtKB/Swiss-Prot
	PTHR22761	UniProtKB/Swiss-Prot
Pfam	Snf7	UniProtKB/Swiss-Prot
PhenoGen	Chmp4c	PhenoGen
RatGTEx	ENSRNOG00000010238	RatGTEx
UniProt	A0ABK0L8G6_RAT	UniProtKB/TrEMBL
	CHM4C_RAT	UniProtKB/Swiss-Prot
	F1LPT7	ENTREZGENE, UniProtKB/TrEMBL
	Q569C1	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-09-29	Chmp4c	charged multivesicular body protein 4C	Chmp4c	chromatin modifying protein 4C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Chmp4c	chromatin modifying protein 4C	MGC108776	Snf7 homologue associated with Alix 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	MGC108776	Snf7 homologue associated with Alix 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)