Advanced Search (OLGA)

Gene: Gltp (glycolipid transfer protein) Rattus norvegicus

Analyze

Symbol:

Gltp

Name:

glycolipid transfer protein

RGD ID:

1564442

Description:

Predicted to enable several functions, including ceramide 1-phosphate binding activity; ceramide 1-phosphate transfer activity; and identical protein binding activity. Involved in response to immobilization stress. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Orthologous to human GLTP (glycolipid transfer protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC288707; RGD1564442; similar to Glycolipid transfer protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GLTP (glycolipid transfer protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gltp (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gltp (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GLTP (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GLTP (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gltp (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GLTP (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GLTP (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gltp (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gltp (glycolipid transfer protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GLTP (glycolipid transfer protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gltp (glycolipid transfer protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gltpa (glycolipid transfer protein a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y82E9BR.14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	Y82E9BR.14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6299	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6299	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gltp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	47,567,797 - 47,587,949 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	47,567,770 - 47,587,946 (+)	Ensembl				GRCr8
mRatBN7.2	12	41,907,168 - 41,927,321 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,907,144 - 41,927,319 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	43,074,813 - 43,094,979 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	43,688,391 - 43,708,557 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,748,885 - 42,769,054 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	47,667,556 - 47,687,708 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	47,667,556 - 47,687,707 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	49,460,373 - 49,480,641 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	43,195,541 - 43,215,694 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	43,521,019 - 43,541,171 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dinitrotoluene (EXP)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

choline (ISO)

cisplatin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

doxorubicin (ISO)

ethyl methanesulfonate (ISO)

fenamidone (ISO)

folic acid (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

furan (EXP)

furfural (ISO)

indole-3-methanol (EXP)

ivermectin (ISO)

L-methionine (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

nitric oxide (ISO)

paracetamol (EXP)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

progesterone (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ceramide 1-phosphate transport (IEA)

ceramide transport (IBA)

glycolipid transport (IEA)

intermembrane lipid transfer (IBA,IEA,ISO,ISS)

lipid transport (IEA)

response to immobilization stress (IEP)

Cellular Component

cytoplasm (IEA)

cytosol (IBA,IEA,ISO,ISS)

Molecular Function

ceramide 1-phosphate binding (IBA)

ceramide 1-phosphate transfer activity (IBA)

glycolipid binding (IEA,ISO)

glycolipid transfer activity (IEA,ISO,ISS)

identical protein binding (IEA,ISO)

lipid binding (IEA,ISO)

lipid transfer activity (IEA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Enriched Environment Enhances the Myelin Regulatory Factor by mTOR Signaling and Protects the Myelin Membrane Against Oxidative Damage in Rats Exposed to Chronic Immobilization Stress.	Thamizhoviya G and Vanisree AJ, Neurochem Res. 2021 Dec;46(12):3314-3324. doi: 10.1007/s11064-021-03433-8. Epub 2021 Aug 27.

Additional References at PubMed

PMID:12477932	PMID:15287756	PMID:15901739	PMID:22078563	PMID:22871113	PMID:23376485

Genomics

Comparative Map Data

Gltp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	47,567,797 - 47,587,949 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	47,567,770 - 47,587,946 (+)	Ensembl				GRCr8
mRatBN7.2	12	41,907,168 - 41,927,321 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,907,144 - 41,927,319 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	43,074,813 - 43,094,979 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	43,688,391 - 43,708,557 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	42,748,885 - 42,769,054 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	47,667,556 - 47,687,708 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	47,667,556 - 47,687,707 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	49,460,373 - 49,480,641 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	43,195,541 - 43,215,694 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	43,521,019 - 43,541,171 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

GLTP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	109,850,945 - 109,880,541 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	109,850,943 - 109,880,541 (-)	Ensembl			hg38	GRCh38
GRCh37	12	110,288,750 - 110,318,346 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	108,773,131 - 108,802,676 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	109,913,104 - 109,942,641 (-)	NCBI		Celera
Cytogenetic Map	12	q24.11	NCBI
HuRef	12	107,304,600 - 107,334,378 (-)	NCBI		HuRef
CHM1_1	12	110,256,554 - 110,286,100 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	109,826,404 - 109,856,233 (-)	NCBI		T2T-CHM13v2.0

Gltp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	114,807,551 - 114,828,996 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	114,807,459 - 114,829,045 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	114,669,490 - 114,690,935 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	114,669,398 - 114,690,984 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	115,119,499 - 115,140,944 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	114,930,489 - 114,951,934 (-)	NCBI		MGSCv36	mm8
Celera	5	111,766,920 - 111,787,950 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	55.99	NCBI

Gltp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	8,712,873 - 8,735,447 (+)	Ensembl
ChiLan1.0	NW_004955455	8,713,152 - 8,735,320 (+)	NCBI	ChiLan1.0	ChiLan1.0

GLTP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	117,900,720 - 117,947,412 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	117,897,117 - 117,943,814 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	107,426,884 - 107,456,453 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	110,822,948 - 110,851,279 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	110,822,953 - 110,851,279 (-)	Ensembl			panPan2	panpan1.1

GLTP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	17,262,008 - 17,283,735 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	17,262,100 - 17,330,165 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	18,518,276 - 18,539,992 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	17,606,684 - 17,628,412 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	17,606,528 - 17,627,610 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	18,728,266 - 18,749,980 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	17,596,497 - 17,618,179 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	17,613,594 - 17,635,322 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gltp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	143,985,787 - 144,010,593 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936769	1,465,271 - 1,490,214 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936769	1,465,301 - 1,490,110 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GLTP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	41,091,628 - 41,115,964 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	41,091,633 - 41,115,968 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	43,607,251 - 43,631,567 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GLTP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	105,090,786 - 105,121,101 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	105,090,780 - 105,121,037 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	139,999,768 - 140,030,039 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gltp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	10,613,719 - 10,637,343 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	10,613,751 - 10,637,252 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gltp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	39,259,163 - 39,279,641 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	546
Count of miRNA genes:	254
Interacting mature miRNAs:	311
Transcripts:	ENSRNOT00000001581
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

RH128373

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,927,049 - 41,927,262 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	47,687,437 - 47,687,649	NCBI	Rnor6.0
Rnor_5.0	12	49,480,370 - 49,480,582	UniSTS	Rnor5.0
RGSC_v3.4	12	43,215,423 - 43,215,635	UniSTS	RGSC3.4
Celera	12	43,540,900 - 43,541,112	UniSTS
RH 3.4 Map	12	817.71	UniSTS
Cytogenetic Map	12	q16	UniSTS

RH143763

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	41,927,051 - 41,927,159 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	47,687,439 - 47,687,546	NCBI	Rnor6.0
Rnor_5.0	12	49,480,372 - 49,480,479	UniSTS	Rnor5.0
RGSC_v3.4	12	43,215,425 - 43,215,532	UniSTS	RGSC3.4
Celera	12	43,540,902 - 43,541,009	UniSTS
RH 3.4 Map	12	778.12	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095845	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158884	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001581 ⟹ ENSRNOP00000001581

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	47,567,770 - 47,587,946 (+)	Ensembl
mRatBN7.2 Ensembl	12	41,907,144 - 41,927,319 (+)	Ensembl
Rnor_6.0 Ensembl	12	47,667,556 - 47,687,707 (+)	Ensembl

RefSeq Acc Id:

NM_001134413 ⟹ NP_001127885

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	47,567,797 - 47,587,949 (+)	NCBI
mRatBN7.2	12	41,907,168 - 41,927,321 (+)	NCBI
Rnor_6.0	12	47,667,556 - 47,687,708 (+)	NCBI
Rnor_5.0	12	49,460,373 - 49,480,641 (+)	NCBI
RGSC_v3.4	12	43,195,541 - 43,215,694 (+)	RGD
Celera	12	43,521,019 - 43,541,171 (+)	RGD

Sequence:

show sequence

CGACAGCCCGGGCGCGGACGCCCTCGGCGCGGGCTGGGGCATCACCAAGGGCCTCGACCCCGAA
ATGGCGCTGCTGGCCGAGCACCTGCTCAAGCCGCTACCCGCAGACCGGCAGATCGAGACCGGGC
CCTTCTTGGAGGCGGTGGCCCACCTGCCGCCCTTCTTCGATTGCCTTGGGTCCCCGGTGTTCAC
GCCCATCAAGGCAGACATAAGCGGTAACATCACCAAAATCAAAGCCGTCTATGACACTGACCCG
GCCAAGTTCAAGACTCTGCAGAACATCCTGGAGGTGGAGAAGGGGATGTATGGGGCGGAGTGGC
CCAAAGTGGGGGCCACGCTGGCACTGCTGTGGCTGAAAAGGGGCCTGCGCTTCATCCAGGTGTT
CCTGCAGAGCATCTGCGATGGCGAACGGGACGAGAACCACCCCAACCTCATCCGGGTAAACGCC
AACAAGGCCTATGAGATGGCGCTAAAGAAGTATCACGGCTGGCTGGTGCAGAAGATCTTCAAGG
CCGCACTGTATGCAGCACCATACAAGTCTGACTTCCTAAAGGCGCTCTCCAAGGGGCAGAACGT
GACGGAGGAGGAGTGCCTGGAGAAGATCCGCCTCTTCCTGGTCAACTACACGGCCACCATCGAC
GCCATCTATGAAATGTATACCAAGATGAACGCGGAGCTTGACTACACCGTGTAGGCGCCCAGAC
ACACAGCCCCACGTGGACACACAGCCCACATGGACACACAGCCCACGTGGACACACAGCCCCAC
GTGGGCACAAGCAGCCCCATCACTGTGAAACAAGCTGGGATCCCCAGCTCAGCCTGGCCCGCCT
GGCCAGCGTGGGTCTGCAGGGGGCGGCCTTAGCTTGTTAGAGGTCTTTTGTTTTCTTGTTTTTG
TTATCTTGGCCTTTTCTAATGGAGCAATAAACACCCTCCACTCACTCCAGCTTCCCCAGCAGCT
CAGGCTGAACCAACCTCCTTCCAGTGTGGTTAAAACCAATTAACTTTGCTAACGATGAATTCCT
AGGGTTTTGTCTTTCCCTCCCCTACCTAGCTCAGGAGGAGCCCAACTCAGGGGAGACATACACC
TCACCCAGCAAAGAAGCCAGGTCCATCCGGCCCAAGGGTGTCTTGGATGTTTGAAGGACAATGG
AGGCGGATGGGAAATTCAGCAGGGCCCAACTGTGGTGTCTGTTTAAAAGGCGAGCTGACAGGGT
CCTCACGGGGCTGCACATCTGGCATTACCAGCCCTGTTCTCTCTCTCCCTCTGTCTTGTCAGAC
AGGTTTTTTTGTTTCTCCTGAATTGTTACCAGCCTTTCAAATGACCGCCTAGGCACACACAGGC
GACCGTCCGTGACTGAACTCGCATTCTTCTGCATAATGCTTTCTTCCTCAGGGTTGGCTCTTCC
AACCCAAGAAACTGCCTGTCACGGGGCCCTCCAGCTGCGGAGACCCAAGAAACTGCCTTGCTGC
CTTAAACCGTCCTTCAGGAGCTAAAAGAGCTATATTTTTTTTAAAGTATCGGGGTTAAACACAT
CCTGAAAGAATTGATGTATGTTAAAAAAAAAAAAAACCCAATGAGGAACAATTGGTGATTTTTA
TGCAGAAACTAAATAATCCTTAATAAATAAATCTATATTTTGAAATCACAAAAAAAAAAAAAAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001127885	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58885	(Get FASTA)	NCBI Sequence Viewer
	B0BNM9	(Get FASTA)	NCBI Sequence Viewer
	EDM13930	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001581
	ENSRNOP00000001581.5

RefSeq Acc Id:

NP_001127885 ⟸ NM_001134413

- UniProtKB:

B0BNM9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDP
AKFKTLQNILEVEKGMYGAEWPKVGATLALLWLKRGLRFIQVFLQSICDGERDENHPNLIRVNA
NKAYEMALKKYHGWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATID
AIYEMYTKMNAELDYTV

hide sequence

Ensembl Acc Id:

ENSRNOP00000001581 ⟸ ENSRNOT00000001581

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BNM9-F1-model_v2	AlphaFold	B0BNM9	1-209	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698709

Promoter ID:

EPDNEW_R9234

Type:

initiation region

Name:

Gltp_1

Description:

glycolipid transfer protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	47,667,529 - 47,667,589	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564442	AgrOrtholog
BioCyc Gene	G2FUF-18953	BioCyc
Ensembl Genes	ENSRNOG00000001192	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000001581	ENTREZGENE
	ENSRNOT00000001581.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.3520.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7938728	IMAGE-MGC_LOAD
InterPro	GLTP_sf	UniProtKB/Swiss-Prot
	Glycolipid_transfer_prot_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:288707	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188604	IMAGE-MGC_LOAD
NCBI Gene	288707	ENTREZGENE
PANTHER	GLYCOLIPID TRANSFER PROTEIN	UniProtKB/Swiss-Prot
	GLYCOLIPID TRANSFER PROTEIN-RELATED	UniProtKB/Swiss-Prot
Pfam	GLTP	UniProtKB/Swiss-Prot
PhenoGen	Gltp	PhenoGen
RatGTEx	ENSRNOG00000001192	RatGTEx
Superfamily-SCOP	SSF110004	UniProtKB/Swiss-Prot
UniProt	B0BNM9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Gltp	glycolipid transfer protein	Gltp_predicted	glycolipid transfer protein (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Gltp_predicted	glycolipid transfer protein (predicted)	RGD1564442_predicted	similar to Glycolipid transfer protein (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1564442_predicted	similar to Glycolipid transfer protein (predicted)	LOC288707	similar to Glycolipid transfer protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC288707	similar to Glycolipid transfer protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message