Advanced Search (OLGA)

Gene: Cimap1b (ciliary microtubule associated protein 1B) Rattus norvegicus

Analyze

Symbol:

Cimap1b

Name:

ciliary microtubule associated protein 1B

RGD ID:

1564322

Description:

Predicted to be active in cytoskeleton. Orthologous to human CIMAP1B (ciliary microtubule associated protein 1B); INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC500917; Odf3b; outer dense fiber of sperm tails 3B; outer dense fiber protein 3B; RGD1564322; similar to shippo 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,323,860 - 122,326,921 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	122,323,860 - 122,326,876 (-)	Ensembl				GRCr8
mRatBN7.2	7	120,444,232 - 120,447,294 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,444,232 - 120,446,749 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	122,195,730 - 122,198,356 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,421,884 - 124,424,510 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,384,591 - 124,387,216 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,347,945 - 130,351,573 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,347,945 - 130,350,570 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	130,033,126 - 130,036,263 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	127,671,982 - 127,674,607 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	116,917,196 - 116,919,821 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

fipronil (EXP)

furan (EXP)

indole-3-methanol (EXP)

iron dichloride (ISO)

maneb (ISO)

mercury dibromide (ISO)

methimazole (EXP)

N-nitrosodiethylamine (ISO)

naled (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP)

paraquat (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

potassium dichromate (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

sodium dichromate (EXP)

tamoxifen (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

triphenyl phosphate (EXP,ISO)

Triptolide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

cytoskeleton (IBA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Cimap1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	122,323,860 - 122,326,921 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	122,323,860 - 122,326,876 (-)	Ensembl				GRCr8
mRatBN7.2	7	120,444,232 - 120,447,294 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	120,444,232 - 120,446,749 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	122,195,730 - 122,198,356 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	124,421,884 - 124,424,510 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	124,384,591 - 124,387,216 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	130,347,945 - 130,351,573 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	130,347,945 - 130,350,570 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	130,033,126 - 130,036,263 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	127,671,982 - 127,674,607 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	116,917,196 - 116,919,821 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

CIMAP1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	50,530,426 - 50,532,498 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	50,529,710 - 50,532,520 (-)	Ensembl			hg38	GRCh38
GRCh37	22	50,968,855 - 50,970,927 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	49,315,721 - 49,317,874 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	22	34,844,865 - 34,847,035 (-)	NCBI		Celera
Cytogenetic Map	22	q13.33	NCBI
HuRef	22	33,859,856 - 33,862,025 (-)	NCBI		HuRef
CHM1_1	22	50,927,544 - 50,929,714 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	51,040,987 - 51,043,059 (-)	NCBI		T2T-CHM13v2.0

Cimap1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	89,261,652 - 89,263,817 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	89,261,652 - 89,263,790 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	89,377,447 - 89,379,254 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	89,377,449 - 89,379,587 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	89,207,880 - 89,209,685 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	89,205,216 - 89,207,021 (-)	NCBI		MGSCv36	mm8
Celera	15	91,506,590 - 91,508,395 (-)	NCBI		Celera
Cytogenetic Map	15	E3	NCBI
cM Map	15	44.86	NCBI

Cimap1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	33,509,244 - 33,510,607 (-)	Ensembl
ChiLan1.0	NW_004955413	33,509,185 - 33,511,002 (-)	NCBI	ChiLan1.0	ChiLan1.0

CIMAP1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	60,450,299 - 60,453,077 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	63,141,109 - 63,143,412 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	30,776,765 - 30,779,060 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	49,887,093 - 49,889,701 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	49,887,093 - 49,889,488 (-)	Ensembl			panPan2	panpan1.1

CIMAP1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	16,779,661 - 16,785,392 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	16,783,169 - 16,786,341 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	16,761,456 - 16,764,574 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	17,510,218 - 17,513,337 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	17,510,351 - 17,513,247 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	17,234,507 - 17,237,624 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	17,557,077 - 17,560,645 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	17,689,749 - 17,692,868 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cimap1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	312,963 - 314,994 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936629	313,441 - 314,936 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936629	313,441 - 314,936 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIMAP1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	215,967 - 217,974 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	215,972 - 217,973 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	110,562,326 - 110,564,334 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CIMAP1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	33,001,537 - 33,004,063 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	33,001,954 - 33,003,852 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	92,338,139 - 92,341,061 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cimap1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	251,038 - 252,381 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	250,190 - 252,440 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cimap1b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	258,676,286 - 258,679,526 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cimap1b
13 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	161
Count of miRNA genes:	123
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000055805
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	121393075	137014596	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	119280025	135560836	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	115313999	136544683	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
1582240	Sffal1	Serum free fatty acids level QTL 1	3.4	0.0021	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	7	118556868	125929417	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	116269196	132020414	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	8	38	114	86	86	55	81	55	6	285	139	1	96	69	85	31	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001414978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000055805 ⟹ ENSRNOP00000052661

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	122,323,860 - 122,326,876 (-)	Ensembl
mRatBN7.2 Ensembl	7	120,444,232 - 120,446,749 (-)	Ensembl
Rnor_6.0 Ensembl	7	130,347,945 - 130,350,570 (-)	Ensembl

RefSeq Acc Id:

NM_001191992 ⟹ NP_001178921

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	122,323,860 - 122,326,921 (-)	NCBI
mRatBN7.2	7	120,444,232 - 120,447,294 (-)	NCBI
Rnor_6.0	7	130,347,945 - 130,350,570 (-)	NCBI
Rnor_5.0	7	130,033,126 - 130,036,263 (-)	NCBI
Celera	7	116,917,196 - 116,919,821 (-)	NCBI

Sequence:

show sequence

ATGGGCTCAGAAGTCTGGGTCGGCACTTGGCGGCCACATCGGCCCCGCGTCCCCATCGCGGCGC
TCTACCGAGGCCCGGGGCCAAAATACAAGCTGCCACCAAACACCGGTTACAAACTGCACGACCC
ATCTCGGCCGCGAGCCCCCGCCTTCTCCTTCGGCTCGCGTCTACCCTTGCGGCATGCAACCTGC
GGACCGGGACCGAGTTACCTGGTGCCTGCCGGCATGACTGCGCGCGGCAGCGTTGTCTCCCCGG
CCTTCTCCATCTATGGTCGCCTAAGCCACATAACGCCTGTCCTCACTCCGGGACCGGGCAGGTA
CTTCCCAGAACGCGCGGGAAATGTGACGTATCCCAGCGCCCCTCGGCATACCATCGCTTCCCGA
AACTGGGGCATCGTCTCAAAGCAACAAACCCCAGGCCCTGGGTCCTATACCGTGCCTTCGCTCT
TGGGCTCACGTGTCATAGGCAAAGTCTCAGCTCCAACTTACTCCATCTACGGCCGCAGCGCTGT
GGGCAGCTGCTTCGAGGACCTCAGCAAGACCCCAGGCCCTTGTGCCTACCACGTTGTGAACCCA
GGGATCTACAAGACTCGAGCCCCGCAGTTCACGATGCTGGGGCGGACTTTGCCACCAAAGAGCC
CCAAAGATCCAGGACCCGCATCCTACGCCGTGGACAAGGTGGTCTGGAGTCGAGGGTCAAGGGG
CAGGGGATGAGGGTCTGAGGTCTAAGGCATGGGTCAAAGTCCCTGGGGAACTGGTATCCCTGTA
TGAAGCCGAACAGCTGGCTCGGTAAGGTAAGCGGCGTCTCCCGGACCCGCAGCACCGGAAGCCT
CCTCCTGGCTGGACCTTCGGGATCAGGCATTCAGACTACCTGGCCCCCATGATACGGTACCACG
TGGACGACTGACGCCAGCAAGCACGCATGCACGGGCCCTCGGTTGTTTATTTAAAGCTTTCAAA
GTCA

hide sequence

RefSeq Acc Id:

NM_001414978 ⟹ NP_001401907

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	122,323,860 - 122,326,921 (-)	NCBI
mRatBN7.2	7	120,444,232 - 120,447,294 (-)	NCBI

RefSeq Acc Id:

XM_063264144 ⟹ XP_063120214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	122,323,860 - 122,326,907 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178921	(Get FASTA)	NCBI Sequence Viewer
	NP_001401907	(Get FASTA)	NCBI Sequence Viewer
	XP_063120214	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL76565	(Get FASTA)	NCBI Sequence Viewer
	EDL76566	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000052661.4

RefSeq Acc Id:	NP_001178921 ⟸ NM_001191992
- Peptide Label:	isoform 2
- UniProtKB:	D4AD19 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGSEVWVGTWRPHRPRVPIAALYRGPGPKYKLPPNTGYKLHDPSRPRAPAFSFGSRLPLRHATC GPGPSYLVPAGMTARGSVVSPAFSIYGRLSHITPVLTPGPGRYFPERAGNVTYPSAPRHTIASR NWGIVSKQQTPGPGSYTVPSLLGSRVIGKVSAPTYSIYGRSAVGSCFEDLSKTPGPCAYHVVNP GIYKTRAPQFTMLGRTLPPKSPKDPGPASYAVDKVVWSRGSRGRG hide sequence

Ensembl Acc Id:

ENSRNOP00000052661 ⟸ ENSRNOT00000055805

RefSeq Acc Id:	NP_001401907 ⟸ NM_001414978
- Peptide Label:	isoform 1
- UniProtKB:	D4AD19 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063120214 ⟸ XM_063264144
- Peptide Label:	isoform X1
- UniProtKB:	D4AD19 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AD19-F1-model_v2	AlphaFold	D4AD19	1-237	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564322	AgrOrtholog
BioCyc Gene	G2FUF-32438	BioCyc
Ensembl Genes	ENSRNOG00000037060	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000055805.5	UniProtKB/TrEMBL
InterPro	CIMAP	UniProtKB/TrEMBL
	DUF1309	UniProtKB/TrEMBL
NCBI Gene	500917	ENTREZGENE
PANTHER	OUTER DENSE FIBER PROTEIN 3B	UniProtKB/TrEMBL
	SHIPPO-1-RELATED	UniProtKB/TrEMBL
Pfam	DUF1309	UniProtKB/TrEMBL
PhenoGen	Cimap1b	PhenoGen
RatGTEx	ENSRNOG00000037060	RatGTEx
UniProt	D4AD19	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-05-05	Cimap1b	ciliary microtubule associated protein 1B	Odf3b	outer dense fiber of sperm tails 3B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-12	Odf3b	outer dense fiber of sperm tails 3B	RGD1564322	similar to shippo 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1564322	similar to shippo 1	RGD1564322_predicted	similar to shippo 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1564322_predicted	similar to shippo 1 (predicted)	LOC500917	similar to shippo 1	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500917	similar to shippo 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD