Advanced Search (OLGA)

Gene: Ankrd33b (ankyrin repeat domain 33B) Rattus norvegicus

Analyze

Symbol:

Ankrd33b

Name:

ankyrin repeat domain 33B

RGD ID:

1564227

Description:

Orthologous to human ANKRD33B (ankyrin repeat domain 33B); INTERACTS WITH 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ankyrin repeat domain-containing protein 33B; LOC310200; RGD1564227; similar to RIKEN cDNA 5730557B15

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ANKRD33B (ankyrin repeat domain 33B)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ankrd33b (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ankrd33b (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ANKRD33B (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ANKRD33B (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ankrd33b (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ANKRD33B (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ANKRD33B (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ankrd33b (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ankrd33b (ankyrin repeat domain 33B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TLR3 (toll like receptor 3)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Ankrd33b (ankyrin repeat domain 33B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ANKRD33B (ankyrin repeat domain 33B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ankrd33ba (ankyrin repeat domain 33ba)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ankrd33bb (ankyrin repeat domain 33Bb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ankrd33bb (ankyrin repeat domain 33Bb)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ankrd33b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	83,988,505 - 84,070,311 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	83,993,974 - 84,070,936 (-)	Ensembl				GRCr8
mRatBN7.2	2	82,277,604 - 82,359,420 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	82,283,108 - 82,358,872 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	89,323,286 - 89,398,995 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	87,444,873 - 87,520,580 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	82,501,134 - 82,576,855 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	84,361,061 - 84,436,912 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	84,361,061 - 84,437,084 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	104,034,185 - 104,110,203 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	83,369,613 - 83,446,622 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	77,806,510 - 77,882,181 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

Dibutyl phosphate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

lead diacetate (ISO)

leflunomide (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triclosan (ISO)

triphenyl phosphate (EXP,ISO)

troglitazone (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Ankrd33b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	83,988,505 - 84,070,311 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	83,993,974 - 84,070,936 (-)	Ensembl				GRCr8
mRatBN7.2	2	82,277,604 - 82,359,420 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	82,283,108 - 82,358,872 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	89,323,286 - 89,398,995 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	87,444,873 - 87,520,580 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	82,501,134 - 82,576,855 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	84,361,061 - 84,436,912 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	84,361,061 - 84,437,084 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	104,034,185 - 104,110,203 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	83,369,613 - 83,446,622 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	77,806,510 - 77,882,181 (-)	NCBI		Celera
Cytogenetic Map	2	q23	NCBI

ANKRD33B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	10,564,070 - 10,657,816 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	10,564,070 - 10,657,816 (+)	Ensembl			hg38	GRCh38
GRCh37	5	10,564,182 - 10,657,928 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	10,615,464 - 10,703,225 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	5	10,602,518 - 10,695,071 (+)	NCBI		Celera
Cytogenetic Map	5	p15.2	NCBI
HuRef	5	10,548,592 - 10,640,738 (+)	NCBI		HuRef
CHM1_1	5	10,564,397 - 10,657,792 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	10,503,260 - 10,595,837 (+)	NCBI		T2T-CHM13v2.0

Ankrd33b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	31,278,328 - 31,370,446 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	31,291,624 - 31,367,872 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	31,291,479 - 31,367,802 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	31,291,478 - 31,367,726 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	31,221,234 - 31,297,514 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	31,241,253 - 31,312,154 (-)	NCBI		MGSCv36	mm8
Celera	15	31,976,877 - 32,055,999 (-)	NCBI		Celera
Cytogenetic Map	15	B2	NCBI
cM Map	15	12.76	NCBI

Ankrd33b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955426	363,297 - 384,415 (+)	Ensembl
ChiLan1.0	NW_004955426	363,297 - 383,013 (+)	NCBI	ChiLan1.0	ChiLan1.0

ANKRD33B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	10,805,733 - 10,899,234 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	8,957,133 - 9,052,845 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	10,878,054 - 10,970,319 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ANKRD33B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	3,698,806 - 3,780,942 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	3,704,756 - 3,782,120 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	8,202,771 - 8,284,369 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	3,604,295 - 3,685,993 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	3,608,534 - 3,686,201 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	3,654,446 - 3,736,021 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	3,632,005 - 3,714,404 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	3,863,692 - 3,945,438 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ankrd33b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	236,561,085 - 236,786,441 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936643	2,617,458 - 2,754,779 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ANKRD33B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	149,431 - 233,791 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	16	149,486 - 233,815 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	86,756,584 - 86,843,825 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ANKRD33B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	10,092,511 - 10,183,437 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	10,092,651 - 10,175,664 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666064	18,361,391 - 18,452,231 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ankrd33b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	7,850,928 - 7,887,565 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624751	7,850,857 - 7,888,151 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ankrd33b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	149,457,560 - 149,530,429 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ankrd33b
675 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	96
Count of miRNA genes:	70
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000059565
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	61556902	106556902	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	78269809	104744824	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	44904355	85286097	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	51266859	96266859	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	44904355	89904355	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Markers in Region

D2Rat95

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	84,027,348 - 84,027,558 (+)	Marker Load Pipeline
mRatBN7.2	2	82,316,452 - 82,316,662 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,394,688 - 84,394,897	NCBI	Rnor6.0
Rnor_5.0	2	104,067,812 - 104,068,021	UniSTS	Rnor5.0
RGSC_v3.4	2	83,403,024 - 83,403,435	RGD	RGSC3.4
RGSC_v3.4	2	83,403,087 - 83,403,296	UniSTS	RGSC3.4
Celera	2	77,839,883 - 77,840,092	UniSTS
RGSC_v3.1	2	83,348,049 - 83,348,258	RGD
RH 3.4 Map	2	516.6	UniSTS
RH 3.4 Map	2	516.6	RGD
RH 2.0 Map	2	419.5	RGD
SHRSP x BN Map	2	33.1398	RGD
Cytogenetic Map	2	q22	UniSTS

D2Rat277

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	84,056,790 - 84,057,015 (+)	Marker Load Pipeline
mRatBN7.2	2	82,345,893 - 82,346,118 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,424,139 - 84,424,363	NCBI	Rnor6.0
Rnor_5.0	2	104,097,430 - 104,097,654	UniSTS	Rnor5.0
RGSC_v3.4	2	83,433,833 - 83,434,058	RGD	RGSC3.4
RGSC_v3.4	2	83,433,834 - 83,434,058	UniSTS	RGSC3.4
Celera	2	77,869,393 - 77,869,617	UniSTS
RGSC_v3.1	2	83,378,795 - 83,379,020	RGD
SHRSP x BN Map	2	33.1798	UniSTS
SHRSP x BN Map	2	33.1798	RGD
Cytogenetic Map	2	q22	UniSTS

BF405011

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	83,993,926 - 83,994,137 (+)	Marker Load Pipeline
mRatBN7.2	2	82,283,025 - 82,283,236 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,361,014 - 84,361,224	NCBI	Rnor6.0
Rnor_5.0	2	104,034,138 - 104,034,348	UniSTS	Rnor5.0
RGSC_v3.4	2	83,369,566 - 83,369,776	UniSTS	RGSC3.4
Celera	2	77,806,463 - 77,806,673	UniSTS
Cytogenetic Map	2	q22	UniSTS

RH139337

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	82,347,082 - 82,347,202 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,425,328 - 84,425,447	NCBI	Rnor6.0
Rnor_5.0	2	104,098,619 - 104,098,738	UniSTS	Rnor5.0
RGSC_v3.4	2	83,435,023 - 83,435,142	UniSTS	RGSC3.4
Celera	2	77,870,582 - 77,870,701	UniSTS
Cytogenetic Map	2	q22	UniSTS

AI412966

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	82,282,613 - 82,282,794 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,360,602 - 84,360,782	NCBI	Rnor6.0
Rnor_5.0	2	104,033,726 - 104,033,906	UniSTS	Rnor5.0
RGSC_v3.4	2	83,369,154 - 83,369,334	UniSTS	RGSC3.4
Celera	2	77,806,051 - 77,806,231	UniSTS
RH 3.4 Map	2	516.3	UniSTS
Cytogenetic Map	2	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	162	91	90	59	92	59	6	355	191	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102227	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005500280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	FQ232932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000059565 ⟹ ENSRNOP00000056322

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	83,994,009 - 84,069,768 (-)	Ensembl
mRatBN7.2 Ensembl	2	82,283,108 - 82,358,872 (-)	Ensembl
Rnor_6.0 Ensembl	2	84,361,061 - 84,436,912 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077598 ⟹ ENSRNOP00000071061

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	84,361,207 - 84,437,084 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000142183 ⟹ ENSRNOP00000106740

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	83,993,974 - 84,070,936 (-)	Ensembl

RefSeq Acc Id:

NM_001191565 ⟹ NP_001178494

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	83,993,974 - 84,069,579 (-)	NCBI
mRatBN7.2	2	82,283,073 - 82,358,683 (-)	NCBI
Rnor_6.0	2	84,361,061 - 84,436,912 (-)	NCBI
Rnor_5.0	2	104,034,185 - 104,110,203 (-)	NCBI
Celera	2	77,806,510 - 77,882,181 (-)	NCBI

Sequence:

show sequence

ATGGTGCTGCTGGCTGGGCCCGGGCCGGAGGGCGGCGGGACACGCTGCTTGTCCCCACAGTCGC
CGACGCCACCCCGGAGCGTACAGACAGGGGACGACCCAGCGGACTACGAGGAGTACGAAGACTT
CTCGAGTCTGCCGGACACCCGCAGCATCGCATCGGACGATTCCTTCTACCCTCCGGGAGGCGAG
GAGGAGTGCGGCTCGGTGTGCGCGGAGAGCGTCCCGGAGGGCGTCCCTGAGTCGGCGACCCTCC
TGCGCGCCGCCTGCGCCAACGACGTGGGGCTGCTGCGGGCGCTAGTGCGGCGCGGACCTAGTTC
CGAGGAGGCACGGGAGACTGACCGCAACGGCCGGACTGGCCTTATTATTGCGTGCTACCATGGC
TTTGTGGATACCGTGGTGGCCTTAGCAGAGTGTCCCCACATCGACGTCAACTGGCAGGACAGCG
AAGGGAACACAGCCCTGATCACTGCTGCCCAAGCAGGGCATGCCACCATCACCAACTACTTGCT
GAATTATTTCCCCGGTCTGGACCTAGAAAGGAGGAACATATTCGGCTTCACAGCTCTCATGAAG
GCAGCCATGCAGGGTAGAACAGAATGTGTGCGAGCCCTGATGCTAGCAGGGGCAGACGTTCAAG
CAAGGGATCCCCGACGTGGGCTGTCACCTCAGGAGTGGGCTGCATACACAGGCCGAGCGGAGGC
TGTTCGAGTCATGCAGAGGCTGATGGAGCGACCCTGCCCAGAACAGTTTGGGGACAAGTATAAG
CTGGAATTGCCACTTCCCGCTGAGACGATCTTAAAGAAGGCAGGTTCCAAAAACTGCTTGCAGA
GATTCACCGCATTCCTGCGATCTACTTTGACCTCCCGCTCCGGCCAGAGCCTGGAGGATGGAGG
CGTCCTTGATCACATGGTCAGGATGACCACAAGTCTCTACAGCCCCGCTGTTGCTGTAGTCTGT
CAGACCGTGTGCCCGGAGAACCCACCCTGTGTGGGGAAACGACGCTTGGCGGTACAGGAAATCC
TAGCAGCTAGGGGCAACCTGGACGCCCAAGCGCAGGACAGCAACAACGTAGAGCTGCAATCCCA
GATTTTGGAGACTCCCAGAGCTAGCTCCCGGTCTCCCCAGTCGCTCGGCTCGGGTTCCACTCCT
GCTCCTGTTACTCGGAAGGCCAGCCTCCTGCCTTTGCAGTTGCTACGGAGGAGCAGTGTGCGGC
CGGGCGTGGTGGTCCCTCGAGTGCGCATCAGCAAGGCCCCTGCGCCCACCTTCCAGCCAGAGCG
CGCAGCGTCCAAGGGCAACACCAAGGACAGCATCTATCTGCAGATCCCCAAGTGGCGGTACAAA
GAGGCCAAGGAGGAGAAGAGGAAGGCGGAGGAGGCAGAGAAGAAGCGCCAGGCAGAGGCACAGA
AAGAAAGGCGGGCGCCACGCTGGAGGAAAAGGACGTGAAGGGGCTACGACTCTCATAGGCCTGT
GCCTGGTGTGGGGAAGCAGCGCAGGAATCCTGCTGGGAGGCTGCAAGTGCTGGAGACAGCACCG
TGGAGAGGGATGCTCCTGTCTGCTACGGGGTGCGTGCTGCGTCACACAGCCTCCGGGCCATTCA
CATCTTCTAGATCCACAAAGGACGGTCCACATTGCTCCCAAGACAGAACTGGGAAAAGTACAAG
TGATTTTGTTTAAAACCAGTTCCTTGAGCATTCTGTACACTAAGAGGTCAGTTTACCTAGAAGT
CGCCCTTAAAGAACCCCAATTAAGAATTAAAAAAAAAAAAAAACAACCCAACATATCACAGGG

hide sequence

RefSeq Acc Id:

XM_039102227 ⟹ XP_038958155

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	83,988,505 - 84,053,765 (-)	NCBI
mRatBN7.2	2	82,277,604 - 82,336,124 (-)	NCBI

RefSeq Acc Id:

XM_039102228 ⟹ XP_038958156

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	83,988,505 - 84,037,155 (-)	NCBI
mRatBN7.2	2	82,277,604 - 82,323,002 (-)	NCBI

RefSeq Acc Id:

XM_039102229 ⟹ XP_038958157

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	83,988,505 - 84,006,631 (-)	NCBI
mRatBN7.2	2	82,277,604 - 82,295,731 (-)	NCBI

RefSeq Acc Id:

XR_005500280

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	84,005,857 - 84,070,311 (-)	NCBI
mRatBN7.2	2	82,294,958 - 82,359,420 (-)	NCBI

RefSeq Acc Id:

XR_010063602

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	83,995,003 - 84,070,311 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178494	(Get FASTA)	NCBI Sequence Viewer
	XP_038958155	(Get FASTA)	NCBI Sequence Viewer
	XP_038958156	(Get FASTA)	NCBI Sequence Viewer
	XP_038958157	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000056322
	ENSRNOP00000056322.1
	ENSRNOP00000106740.1

RefSeq Acc Id:

NP_001178494 ⟸ NM_001191565

- UniProtKB:

D3ZTU7 (UniProtKB/TrEMBL), A6JMY9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVLLAGPGPEGGGTRCLSPQSPTPPRSVQTGDDPADYEEYEDFSSLPDTRSIASDDSFYPPGGE
EECGSVCAESVPEGVPESATLLRAACANDVGLLRALVRRGPSSEEARETDRNGRTGLIIACYHG
FVDTVVALAECPHIDVNWQDSEGNTALITAAQAGHATITNYLLNYFPGLDLERRNIFGFTALMK
AAMQGRTECVRALMLAGADVQARDPRRGLSPQEWAAYTGRAEAVRVMQRLMERPCPEQFGDKYK
LELPLPAETILKKAGSKNCLQRFTAFLRSTLTSRSGQSLEDGGVLDHMVRMTTSLYSPAVAVVC
QTVCPENPPCVGKRRLAVQEILAARGNLDAQAQDSNNVELQSQILETPRASSRSPQSLGSGSTP
APVTRKASLLPLQLLRRSSVRPGVVVPRVRISKAPAPTFQPERAASKGNTKDSIYLQIPKWRYK
EAKEEKRKAEEAEKKRQAEAQKERRAPRWRKRT

hide sequence

Ensembl Acc Id:

ENSRNOP00000056322 ⟸ ENSRNOT00000059565

Ensembl Acc Id:

ENSRNOP00000071061 ⟸ ENSRNOT00000077598

RefSeq Acc Id:	XP_038958155 ⟸ XM_039102227
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038958156 ⟸ XM_039102228
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038958157 ⟸ XM_039102229
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000106740 ⟸ ENSRNOT00000142183

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTU7-F1-model_v2	AlphaFold	D3ZTU7	1-481	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691210

Promoter ID:

EPDNEW_R1733

Type:

multiple initiation site

Name:

Ankrd33b_1

Description:

ankyrin repeat domain 33B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	84,437,075 - 84,437,135	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564227	AgrOrtholog
BioCyc Gene	G2FUF-53867	BioCyc
Ensembl Genes	ENSRNOG00000010888	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000059565	ENTREZGENE
	ENSRNOT00000059565.5	UniProtKB/TrEMBL
	ENSRNOT00000142183.1	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.20	UniProtKB/TrEMBL
InterPro	Ankyrin_rpt	UniProtKB/TrEMBL
	Ankyrin_rpt-contain_sf	UniProtKB/TrEMBL
KEGG Report	rno:310200	UniProtKB/TrEMBL
NCBI Gene	310200	ENTREZGENE
PANTHER	ANKYRIN REPEAT CONTAINING	UniProtKB/TrEMBL
	ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 33B	UniProtKB/TrEMBL
Pfam	Ank	UniProtKB/TrEMBL
	Ank_2	UniProtKB/TrEMBL
PhenoGen	Ankrd33b	PhenoGen
PROSITE	ANK_REP_REGION	UniProtKB/TrEMBL
	ANK_REPEAT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010888	RatGTEx
SMART	ANK	UniProtKB/TrEMBL
Superfamily-SCOP	ANK	UniProtKB/TrEMBL
UniProt	A0ABK0LWH0_RAT	UniProtKB/TrEMBL
	A6JMY9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZTU7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-06-12	Ankrd33b	ankyrin repeat domain 33B	RGD1564227	similar to RIKEN cDNA 5730557B15	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1564227	similar to RIKEN cDNA 5730557B15	RGD1564227_predicted	similar to RIKEN cDNA 5730557B15 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1564227_predicted	similar to RIKEN cDNA 5730557B15 (predicted)	LOC310200	similar to RIKEN cDNA 5730557B15	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC310200	similar to RIKEN cDNA 5730557B15			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message