Advanced Search (OLGA)

Gene: Abhd18 (abhydrolase domain containing 18) Rattus norvegicus

Analyze

Symbol:

Abhd18

Name:

abhydrolase domain containing 18

RGD ID:

1563987

Description:

Predicted to be located in extracellular region. Orthologous to human ABHD18 (abhydrolase domain containing 18); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

abhydrolase domain-containing protein 18; alpha/beta hydrolase domain-containing protein 18; hypothetical protein LOC499602; LOC499602; uncharacterized protein C4orf29 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ABHD18 (abhydrolase domain containing 18)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Abhd18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Abhd18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ABHD18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ABHD18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Abhd18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ABHD18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ABHD18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Abhd18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Abhd18 (abhydrolase domain containing 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FNTA (farnesyltransferase, CAAX box, subunit alpha)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ABHD18 (abhydrolase domain containing 18)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Abhd18 (abhydrolase domain containing 18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	abhd18 (abhydrolase domain containing 18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C54G4.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32112	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	abhd18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	abhd18	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	125,800,488 - 125,850,167 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	125,800,392 - 125,850,166 (+)	Ensembl				GRCr8
mRatBN7.2	2	123,872,299 - 123,920,987 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	123,872,386 - 123,920,231 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	130,443,003 - 130,490,691 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	128,555,431 - 128,603,121 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	123,184,579 - 123,232,269 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	127,770,588 - 127,828,218 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	127,770,676 - 127,827,800 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	147,374,140 - 147,429,666 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	127,822,812 - 127,874,232 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	118,780,951 - 118,828,543 (+)	NCBI		Celera
Cytogenetic Map	2	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

acrylamide (ISO)

atrazine (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diazinon (ISO)

doxorubicin (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

methyl methanesulfonate (ISO)

potassium chromate (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

extracellular region (IEA)

mitochondrion (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:34800366

Genomics

Comparative Map Data

Abhd18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	125,800,488 - 125,850,167 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	125,800,392 - 125,850,166 (+)	Ensembl				GRCr8
mRatBN7.2	2	123,872,299 - 123,920,987 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	123,872,386 - 123,920,231 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	130,443,003 - 130,490,691 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	128,555,431 - 128,603,121 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	123,184,579 - 123,232,269 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	127,770,588 - 127,828,218 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	127,770,676 - 127,827,800 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	147,374,140 - 147,429,666 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	127,822,812 - 127,874,232 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	118,780,951 - 118,828,543 (+)	NCBI		Celera
Cytogenetic Map	2	q26	NCBI

ABHD18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	127,965,406 - 128,039,953 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	127,965,267 - 128,039,953 (+)	Ensembl			hg38	GRCh38
GRCh37	4	128,886,561 - 128,961,108 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	129,105,911 - 129,171,918 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	4	126,267,834 - 126,333,840 (+)	NCBI		Celera
Cytogenetic Map	4	q28.2	NCBI
HuRef	4	124,618,536 - 124,684,263 (+)	NCBI		HuRef
CHM1_1	4	128,862,913 - 128,928,926 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	131,269,448 - 131,343,978 (+)	NCBI		T2T-CHM13v2.0

Abhd18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	40,825,532 - 40,892,573 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	40,801,405 - 40,892,573 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	40,871,095 - 40,938,138 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	40,846,970 - 40,938,138 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	40,698,199 - 40,740,229 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	40,990,826 - 41,034,685 (+)	NCBI		MGSCv36	mm8
Celera	3	40,623,547 - 40,665,477 (+)	NCBI		Celera
Cytogenetic Map	3	B	NCBI
cM Map	3	19.58	NCBI

Abhd18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	13,459,147 - 13,519,210 (-)	Ensembl
ChiLan1.0	NW_004955428	13,461,446 - 13,519,184 (-)	NCBI	ChiLan1.0	ChiLan1.0

ABHD18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	125,736,050 - 125,810,331 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	126,002,291 - 126,076,566 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	120,136,126 - 120,207,449 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	131,439,603 - 131,509,386 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	131,439,603 - 131,509,380 (+)	Ensembl			panPan2	panpan1.1

ABHD18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	12,935,971 - 12,982,227 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	12,938,051 - 12,982,259 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	13,124,739 - 13,170,993 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	13,025,915 - 13,072,205 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	13,025,918 - 13,072,184 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	12,998,701 - 13,044,955 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	13,284,596 - 13,330,573 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	13,746,658 - 13,792,910 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Abhd18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	61,465,307 - 61,509,174 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936642	2,761,961 - 2,802,028 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936642	2,762,674 - 2,801,831 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ABHD18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	96,887,464 - 96,924,927 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	96,887,464 - 96,924,862 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	103,755,770 - 103,791,881 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ABHD18
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	75,097,259 - 75,163,277 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	54,235,445 - 54,302,391 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Abhd18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624777	8,876,953 - 8,923,790 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624777	8,877,955 - 8,922,918 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Abhd18
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	113,004,843 - 113,035,898 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Abhd18
216 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	137
Count of miRNA genes:	106
Interacting mature miRNAs:	130
Transcripts:	ENSRNOT00000068405
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	105628029	150628029	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	124103798	154505346	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
2317886	Alcrsp23	Alcohol response QTL 23	2.4	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	95142371	140142371	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	120039407	159440891	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	100807373	145807373	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	106869825	151869825	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
5135226	Leukc2	Leukocyte quantity QTL 2			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	2	120039407	151869825	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
7488933	Bp368	Blood pressure QTL 368		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	104957381	149957381	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	120339555	165339555	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	114032149	150226270	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	116804572	161804572	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Markers in Region

RH130182

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	123,919,886 - 123,920,072 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	127,827,455 - 127,827,640	NCBI	Rnor6.0
Rnor_5.0	2	147,429,321 - 147,429,506	UniSTS	Rnor5.0
RGSC_v3.4	2	127,873,887 - 127,874,072	UniSTS	RGSC3.4
Celera	2	118,828,198 - 118,828,383	UniSTS
RH 3.4 Map	2	662.7	UniSTS
Cytogenetic Map	2	q26	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102873	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282363	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC086604	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB612934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK358190	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000068405 ⟹ ENSRNOP00000059389

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	125,810,510 - 125,848,170 (+)	Ensembl
mRatBN7.2 Ensembl	2	123,872,386 - 123,920,231 (+)	Ensembl
Rnor_6.0 Ensembl	2	127,770,676 - 127,827,796 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093644 ⟹ ENSRNOP00000076238

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	125,800,392 - 125,850,166 (+)	Ensembl
mRatBN7.2 Ensembl	2	123,880,870 - 123,920,228 (+)	Ensembl
Rnor_6.0 Ensembl	2	127,770,750 - 127,827,800 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100570 ⟹ ENSRNOP00000078140

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	123,872,386 - 123,904,084 (+)	Ensembl

RefSeq Acc Id:

NM_001025039 ⟹ NP_001020210

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,800,488 - 125,848,174 (+)	NCBI
mRatBN7.2	2	123,872,538 - 123,920,232 (+)	NCBI
Rnor_6.0	2	127,770,805 - 127,827,800 (+)	NCBI
Rnor_5.0	2	147,374,140 - 147,429,666 (+)	NCBI
RGSC_v3.4	2	127,822,812 - 127,874,232 (+)	RGD
Celera	2	118,780,951 - 118,828,543 (+)	RGD

Sequence:

show sequence

TGGTGCCCAGAGGCTTGGCGAGATCCCCTTTAGGTGTGCGTCCGCGAGCGGCCTATGCTGCTTG
GCACTCATGGGTGTAAGCAAGTTAGATATCCTATACCGGAGACTTCTCCTCACCAAACTTTTCA
TCAGAGGATGGGGAAGGCCAGAAGATCTCAAGAGACTCTTTGAGTTCAGAAAGATGATTGGAAA
TCGAGAAAGGTGCCAGAACCTGGTTTCAAGTGACTATCCGGTACACATCGATAAGGTTGAAGAA
CAGTCAGATTGTAAGATCCTAGATGGACACTTTGTTTCTCCCATGGCCCACTATGTGCCTGGTA
TCATGCCAATTGAGTCTGTTATTGCAAGGTTCCAGTTTATCGTCCCTAAAGAATGGAACAGCAG
ATACAGACCTGTGTGCATTCATCTGGCTGGAACAGGAGACCATCATTATTGGAGGCGCAGAACG
CTCATGGCTCGTCCCATGATTAAGGAGGCCAGAATGGCTTCATTGTTGCTAGAAAACCCTTATT
ATGGCTGCAGGAAGCCCAAGGACCAAGTAAGATCCAGCTTAAAAAATGTGTCTGACCTATTTGT
GATGGGAGGCGCTCTTATTCTTGAGTCTGCAGCTCTCCTGCACTGGCTGGAGAGGGAAGGTTAT
GGACCTCTTGGGATGACTGGGATATCCATGGGAGGACATATGGCCTCCTTAGCAGTGTCCAACT
GGCCCAAGCCCATGCCGTTGATTCCATGCCTGTCTTGGTCCACAGCGTCTGGGGTCTTCACCAC
GGGTGTATTGAGTAAATCAATTAATTGGCGGGAGCTGGAAAAGCAGTATTATACACAGACAGTT
TATGAAGAAGAAATTATTCATATGCTCGAATACTGTGGGACAGATTCTTTCAAAATGGGACACG
AGTTCATGAAACACTTCCCTAGCAATGAAGACAAGCTGACTAACCTGAATCTGGTTTCCAGAAC
TTTAAACTTAGATATGAGAGACCAAGTTGTGTCCCCAAAGCATGCTGAGTGCCATCATTCTGGT
AAAGCATCTATCAGTGCTACTTCAAAAGGACAGCTGTTGCAAGATACAGCTAAGGTGGAACGCT
TGAATCAAACACTCACAACTAACAAAAGTTGTTTTGCAAGTTACAACCCTCAGTCATTACACTT
GCTCAGTAGAGAACAAAGAAGGAGCAACCTTCAAAAAGAATCTTTAATATTCATGAAAGGAGTC
ATGGATGAATGCACTCACGTAGCAAATTTCTCAGTTCCAGTTGACCCGAGCCTCATTATAGTGG
TGCAAGCCAAAGAGGATGCCTATATTCCGCGAACAGGAGTTCGGAGCTTACAAGAAATTTGGCC
TGGCTGTGAAATCCGGTATCTAGAAGGGGGTCATATCAGTGCTTATCTCTTTAAACAGGGACTC
TTCAGACAAGCCATCTACGATGCCTTTGAACGTTTCCTTCATAAATATGCTAACTAATTGGATC
GATGTATGGTATAACATCCTGTCTCCTGCTTTAAAAGAGTTCACCCTATGATGATGTGAAAAAC
AAGCAGACAGCACTACATACCTGATTGCTGCCAAGTGAGTCTGTATGGCCAGTGCTGCAGGCAT
TTACAACTGTAGGCACATTTCAGTAATGTGAAAGCAGTACTTGAATCATACAATCCTGAAGTAT
TTGTAACTCTTAAAAACCTCATATACCTTATATAACATCTGTTGTTACTATTTATAAGGACATT
TTAATTGTGAATAATTTATTGATTCAGGATAAATAGAACTCTACTGGTTTTTAAGAGAATTGTT
GAAACTAAGATTGTAACATCACACGTACTGTATACTGTTATATGGCAGTTTTGCTATTAACTTG
ATTTTAAAAATCCGTGTCTATCCTTTTTGTGTGTGTAGTGGATTTATAATCTGGTTTTCAACTT
TAAGATATTAAACCAGTGTTACCTTTGAATTATGAGCATCCTGAGTGCTGAGCTGTACCCTGTG
TGGTAGTGCACTTGTAATCCCAGCACTTGAGAAGTGGAGACCGGCGAGTCAGGAGTCCAGGCAT
TTTCTTTTTCAGAGCAAATTGAGGCCAGCCTGAGCCATGAGACCCTGTCTCAGAAAACATGCCT
TGCATGGTAACTCATGTCTTTAATCCTAGAGGGCAGGAAGCAGAGACAAGCAGATCTCTTAGAT
GAGTGTCCAGGCTGGGACCGTGCTTGCCCAGCCACTAGACTCGGAGGCCAGTCCCCAGCACTGC
CAACAAAAAGAAAACCTGGAGGTGTTTGAGAAGTGGGGGTTATACATGTTTCCTCTACTTAAGA
GAGATTTATGTTGAAAATGGATATAATAAAAGAACTTTGCACTAGA

hide sequence

RefSeq Acc Id:

XM_039102873 ⟹ XP_038958801

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,831,161 - 125,848,174 (+)	NCBI
mRatBN7.2	2	123,903,019 - 123,920,232 (+)	NCBI

RefSeq Acc Id:

XM_039102874 ⟹ XP_038958802

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,831,161 - 125,848,174 (+)	NCBI
mRatBN7.2	2	123,903,201 - 123,920,232 (+)	NCBI

RefSeq Acc Id:

XM_063282362 ⟹ XP_063138432

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,831,370 - 125,848,174 (+)	NCBI

RefSeq Acc Id:

XM_063282363 ⟹ XP_063138433

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,831,346 - 125,848,174 (+)	NCBI

RefSeq Acc Id:

XM_063282364 ⟹ XP_063138434

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,838,981 - 125,848,174 (+)	NCBI

RefSeq Acc Id:

XR_010063638

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,838,981 - 125,848,174 (+)	NCBI

RefSeq Acc Id:

XR_010063639

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,838,981 - 125,850,167 (+)	NCBI

RefSeq Acc Id:

XR_010063640

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	125,838,981 - 125,850,167 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020210	(Get FASTA)	NCBI Sequence Viewer
	XP_038958801	(Get FASTA)	NCBI Sequence Viewer
	XP_038958802	(Get FASTA)	NCBI Sequence Viewer
	XP_063138432	(Get FASTA)	NCBI Sequence Viewer
	XP_063138433	(Get FASTA)	NCBI Sequence Viewer
	XP_063138434	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86604	(Get FASTA)	NCBI Sequence Viewer
	AAH98046	(Get FASTA)	NCBI Sequence Viewer
	EDM01338	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000076238
GenBank Protein	Q4V7A8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001020210 ⟸ NM_001025039
- Peptide Label:	precursor
- UniProtKB:	Q5RJK2 (UniProtKB/Swiss-Prot), Q4V7A8 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MGVSKLDILYRRLLLTKLFIRGWGRPEDLKRLFEFRKMIGNRERCQNLVSSDYPVHIDKVEEQS DCKILDGHFVSPMAHYVPGIMPIESVIARFQFIVPKEWNSRYRPVCIHLAGTGDHHYWRRRTLM ARPMIKEARMASLLLENPYYGCRKPKDQVRSSLKNVSDLFVMGGALILESAALLHWLEREGYGP LGMTGISMGGHMASLAVSNWPKPMPLIPCLSWSTASGVFTTGVLSKSINWRELEKQYYTQTVYE EEIIHMLEYCGTDSFKMGHEFMKHFPSNEDKLTNLNLVSRTLNLDMRDQVVSPKHAECHHSGKA SISATSKGQLLQDTAKVERLNQTLTTNKSCFASYNPQSLHLLSREQRRSNLQKESLIFMKGVMD ECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYLEGGHISAYLFKQGLFR QAIYDAFERFLHKYAN hide sequence

Ensembl Acc Id:

ENSRNOP00000076238 ⟸ ENSRNOT00000093644

Ensembl Acc Id:

ENSRNOP00000059389 ⟸ ENSRNOT00000068405

RefSeq Acc Id:	XP_038958801 ⟸ XM_039102873
- Peptide Label:	isoform X1
- UniProtKB:	A6II41 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958802 ⟸ XM_039102874
- Peptide Label:	isoform X1
- UniProtKB:	A6II41 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000078140 ⟸ ENSRNOT00000100570

RefSeq Acc Id:	XP_063138433 ⟸ XM_063282363
- Peptide Label:	isoform X1
- UniProtKB:	A6II41 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138432 ⟸ XM_063282362
- Peptide Label:	isoform X1
- UniProtKB:	A6II41 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138434 ⟸ XM_063282364
- Peptide Label:	isoform X2
- UniProtKB:	A6II41 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V7A8-F1-model_v2	AlphaFold	Q4V7A8	1-464	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691306

Promoter ID:

EPDNEW_R1831

Type:

initiation region

Name:

Abhd18_1

Description:

abhydrolase domain containing 18

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	127,770,692 - 127,770,752	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563987	AgrOrtholog
BioCyc Gene	G2FUF-53253	BioCyc
Ensembl Genes	ENSRNOG00000013692	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000093644	ENTREZGENE
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7317121	IMAGE-MGC_LOAD
	IMAGE:7457088	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot
	ABHD18	UniProtKB/Swiss-Prot
KEGG Report	rno:499602	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105757	IMAGE-MGC_LOAD
	MGC:116203	IMAGE-MGC_LOAD
NCBI Gene	499602	ENTREZGENE
PANTHER	PROTEIN ABHD18	UniProtKB/Swiss-Prot
	PTHR13617	UniProtKB/Swiss-Prot
Pfam	DUF2048	UniProtKB/Swiss-Prot
PhenoGen	Abhd18	PhenoGen
RatGTEx	ENSRNOG00000013692	RatGTEx
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot
UniProt	A0A1W2Q6E7_RAT	UniProtKB/TrEMBL
	A6II41	ENTREZGENE, UniProtKB/TrEMBL
	ABD18_RAT	UniProtKB/Swiss-Prot
	D4A556_RAT	UniProtKB/TrEMBL
	Q4V7A8	ENTREZGENE
	Q5RJK2	ENTREZGENE
UniProt Secondary	Q5RJK2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-26	Abhd18	abhydrolase domain containing 18	LOC499602	hypothetical protein LOC499602	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC499602	hypothetical protein LOC499602			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message