Advanced Search (OLGA)

Gene: Dennd11 (DENN domain containing 11) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dennd11

Name:

DENN domain containing 11

RGD ID:

1563986

Description:

Predicted to enable guanyl-nucleotide exchange factor activity. Predicted to be active in cytoplasm. Orthologous to human DENND11 (DENN domain containing 11); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DENN domain-containing protein 11; LCHN; LOC312270; RGD1563986; similar to RIKEN cDNA E330009J07 gene

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DENND11 (DENN domain containing 11)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dennd11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dennd11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DENND11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DENND11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dennd11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DENND11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DENND11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dennd11 (DENN domain containing 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DENND11 (DENN domain containing 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dennd11 (DENN domain containing 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-238n5.4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ANR2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	70,163,869 - 70,232,731 (-)	NCBI		GRCr8
mRatBN7.2	4	69,197,161 - 69,266,013 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	69,198,068 - 69,228,821 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	74,130,661 - 74,157,083 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	70,051,801 - 70,078,231 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	68,463,273 - 68,489,696 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	68,569,308 - 68,597,626 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	68,569,691 - 68,597,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	133,354,586 - 133,383,909 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	67,962,305 - 67,988,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	64,205,409 - 64,231,808 (-)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd11	Rat	RASopathy		ISO	DENND11 (Homo sapiens)	8554872	ClinVar Annotator: match by term: RASopathy	ClinVar	PMID:12414817 more ...
Dennd11	Rat	Sengers syndrome		ISO	DENND11 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Sengers syndrome	ClinVar	PMID:22284826 and PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd11	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of DENND11 mRNA	CTD	PMID:32145629
Dennd11	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of DENND11 mRNA	CTD	PMID:33387578
Dennd11	Rat	2-palmitoylglycerol	increases expression	ISO	DENND11 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of DENND11 mRNA	CTD	PMID:37199045
Dennd11	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Dennd11 (Mus musculus)	6480464	bisphenol S results in decreased expression of DENND11 mRNA	CTD	PMID:39298647
Dennd11	Rat	acrylamide	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Acrylamide results in decreased expression of DENND11 mRNA	CTD	PMID:32763439
Dennd11	Rat	aflatoxin B1	decreases methylation	ISO	DENND11 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of DENND11 gene	CTD	PMID:27153756
Dennd11	Rat	all-trans-retinoic acid	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Tretinoin results in decreased expression of DENND11 mRNA	CTD	PMID:33167477
Dennd11	Rat	aristolochic acid A	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of DENND11 mRNA	CTD	PMID:33212167
Dennd11	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DENND11 mRNA	CTD	PMID:25181051
Dennd11	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of DENND11 mRNA	CTD	PMID:32145629
Dennd11	Rat	bisphenol F	increases expression	ISO	Dennd11 (Mus musculus)	6480464	bisphenol F results in increased expression of DENND11 mRNA	CTD	PMID:38685157
Dennd11	Rat	butanal	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of DENND11 mRNA	CTD	PMID:26079696
Dennd11	Rat	cadmium dichloride	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of DENND11 mRNA	CTD	PMID:38568856
Dennd11	Rat	coumestrol	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Coumestrol results in decreased expression of DENND11 mRNA	CTD	PMID:19167446
Dennd11	Rat	coumestrol	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of DENND11 mRNA	CTD	PMID:19167446
Dennd11	Rat	cyclosporin A	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of DENND11 mRNA	CTD	PMID:20106945 and PMID:25562108
Dennd11	Rat	Dibutyl phosphate	affects expression	ISO	DENND11 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of KIAA1147 mRNA	CTD	PMID:37042841
Dennd11	Rat	diuron	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Diuron results in decreased expression of DENND11 mRNA	CTD	PMID:35967413
Dennd11	Rat	dorsomorphin	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Dennd11	Rat	doxorubicin	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of DENND11 mRNA	CTD	PMID:29803840
Dennd11	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of DENND11 mRNA	CTD	PMID:29391264
Dennd11	Rat	Enterolactone	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of DENND11 mRNA	CTD	PMID:19167446
Dennd11	Rat	entinostat	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	entinostat results in decreased expression of DENND11 mRNA	CTD	PMID:27188386
Dennd11	Rat	genistein	decreases expression	ISO	Dennd11 (Mus musculus)	6480464	Genistein results in decreased expression of DENND11 mRNA	CTD	PMID:32186404
Dennd11	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of DENND11 mRNA	CTD	PMID:33387578
Dennd11	Rat	methylisothiazolinone	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	2-methyl-4-isothiazolin-3-one results in decreased expression of DENND11 mRNA	CTD	PMID:31629900
Dennd11	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of DENND11 mRNA	CTD	PMID:28801915
Dennd11	Rat	paracetamol	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of DENND11 mRNA	CTD	PMID:21420995 and PMID:29067470
Dennd11	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of DENND11 mRNA	CTD	PMID:33387578
Dennd11	Rat	phenylmercury acetate	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of DENND11 mRNA	CTD	PMID:26272509
Dennd11	Rat	phenylmercury acetate	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DENND11 mRNA	CTD	PMID:27188386
Dennd11	Rat	resveratrol	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of DENND11 mRNA	CTD	PMID:23557933
Dennd11	Rat	SB 431542	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386
Dennd11	Rat	temozolomide	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Temozolomide results in decreased expression of DENND11 mRNA	CTD	PMID:31758290
Dennd11	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of DENND11 mRNA	CTD	PMID:23411599
Dennd11	Rat	trichostatin A	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	trichostatin A results in decreased expression of DENND11 mRNA	CTD	PMID:24935251 and PMID:26272509
Dennd11	Rat	trichostatin A	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DENND11 mRNA	CTD	PMID:27188386
Dennd11	Rat	triphenyl phosphate	affects expression	ISO	DENND11 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of KIAA1147 mRNA	CTD	PMID:37042841
Dennd11	Rat	valproic acid	affects expression	ISO	DENND11 (Homo sapiens)	6480464	Valproic Acid affects the expression of DENND11 mRNA	CTD	PMID:25979313
Dennd11	Rat	valproic acid	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of DENND11 mRNA	CTD	PMID:23179753 more ...
Dennd11	Rat	valproic acid	multiple interactions	ISO	DENND11 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DENND11 mRNA	CTD	PMID:27188386
Dennd11	Rat	vorinostat	decreases expression	ISO	DENND11 (Homo sapiens)	6480464	Vorinostat results in decreased expression of DENND11 mRNA	CTD	PMID:27188386

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd11	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN001256550 and UniProtKB:Q8NBF6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd11	Rat	guanyl-nucleotide exchange factor activity	enables	IEA	UniProtKB-KW:KW-0344	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:17394467

Dennd11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	70,163,869 - 70,232,731 (-)	NCBI		GRCr8
mRatBN7.2	4	69,197,161 - 69,266,013 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	69,198,068 - 69,228,821 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	74,130,661 - 74,157,083 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	70,051,801 - 70,078,231 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	68,463,273 - 68,489,696 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	68,569,308 - 68,597,626 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	68,569,691 - 68,597,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	133,354,586 - 133,383,909 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	67,962,305 - 67,988,706 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	64,205,409 - 64,231,808 (-)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI

DENND11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	141,656,728 - 141,702,166 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	141,656,728 - 141,702,166 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	141,356,528 - 141,401,966 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	141,002,997 - 141,048,422 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	136,078,159 - 136,123,586 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI
HuRef	7	135,653,910 - 135,698,743 (-)	NCBI		HuRef
CHM1_1	7	141,290,834 - 141,336,265 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	142,972,579 - 143,017,998 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	140,694,236 - 140,739,666 (-)	NCBI

Dennd11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	40,378,309 - 40,413,069 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	40,378,309 - 40,413,069 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	40,401,375 - 40,436,135 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	40,401,375 - 40,436,135 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	40,357,497 - 40,386,132 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	40,337,105 - 40,365,740 (-)	NCBI		MGSCv36	mm8
Celera	6	40,394,757 - 40,423,431 (-)	NCBI		Celera
Cytogenetic Map	6	B1	NCBI
cM Map	6	18.82	NCBI

Dennd11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955494	1,871,284 - 1,916,443 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955494	1,868,793 - 1,921,919 (+)	NCBI	ChiLan1.0	ChiLan1.0

DENND11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	178,440,083 - 178,485,216 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	30,450,338 - 30,495,458 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	133,578,537 - 133,628,133 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	146,048,756 - 146,082,665 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

DENND11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	7,531,025 - 7,559,156 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	7,531,078 - 7,554,543 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	8,356,983 - 8,403,668 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	7,433,958 - 7,480,398 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	7,433,817 - 7,479,738 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	7,387,220 - 7,433,622 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	7,229,802 - 7,275,963 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	7,297,580 - 7,344,213 (+)	NCBI		UU_Cfam_GSD_1.0

Dennd11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	13,645,548 - 13,687,589 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936592	5,537,657 - 5,560,180 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936592	5,532,214 - 5,574,255 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DENND11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	8,205,600 - 8,261,702 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	8,205,711 - 8,261,704 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	8,498,126 - 8,553,226 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DENND11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	110,349,151 - 110,450,460 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	110,412,647 - 110,450,209 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666072	7,082,301 - 7,170,665 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dennd11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624765	21,673,266 - 21,712,949 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624765	21,663,672 - 21,712,058 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dennd11
220 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	43
Count of miRNA genes:	41
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000015921
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
61336	Bp21	Blood pressure QTL 21	4.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114705	78881294	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
2317577	Eae24	Experimental allergic encephalomyelitis QTL 24			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	66993185	72752834	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	56647776	78882945	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	56647776	78882945	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	56647776	78882945	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	56647776	78882945	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	67386669	70362197	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	65882107	96130297	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	62933508	82490359	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	62933269	87483707	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
631671	Iddm11	Insulin dependent diabetes mellitus QTL 11	3.6	0.0012	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	58635877	78886137	Rat

RH132245

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	69,229,595 - 69,229,775 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	68,598,437 - 68,598,616	NCBI	Rnor6.0
Rnor_5.0	4	133,383,716 - 133,383,895	UniSTS	Rnor5.0
RGSC_v3.4	4	67,989,564 - 67,989,743	UniSTS	RGSC3.4
Celera	4	64,232,666 - 64,232,845	UniSTS
RH 3.4 Map	4	419.11	UniSTS
Cytogenetic Map	4	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001044701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006236361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ836251	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015921 ⟹ ENSRNOP00000015921

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	69,198,068 - 69,228,821 (-)	Ensembl
Rnor_6.0 Ensembl	4	68,569,691 - 68,597,586 (-)	Ensembl

RefSeq Acc Id:

NM_001044701 ⟹ NP_001038166

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	70,163,869 - 70,195,461 (-)	NCBI
mRatBN7.2	4	69,197,161 - 69,228,757 (-)	NCBI
Rnor_6.0	4	68,569,889 - 68,597,579 (-)	NCBI
Rnor_5.0	4	133,354,586 - 133,383,909 (-)	NCBI
RGSC_v3.4	4	67,962,305 - 67,988,706 (-)	RGD
Celera	4	64,205,409 - 64,231,808 (-)	RGD

Sequence:

show sequence

ATGGTGGAGCAGGGAGACGCGGCGCCGCTTCTGCGCTGGGCCGAGGGCCCCGCGGTCTCTGTGCCGCAGGACCCCGCGTTGCAGGCTGGAGGATGGGTCCGGGGCGGCAGTGGGGGCGGCCGAGTGGC
CGCGGAAGCTCCCCGAAGGCGGGAACCCGAGGAGCCAGCTCCCCCCGAAGTGCTGCTGCAGCCCGGGCGCCTGGAGCTGGGCGACGTAGAGGAGGACCAGGTGGTGGCCGTGTTCGTGGTCACCTTCG
ATCCTCGCTCCGGAAACATGGTAGAATGGTGCTTACCTCAAGATATTGACCTTGAAGGTGTCGAGTTCAAGTCTATGGCCAGTGGGTCCCATAAGGTTCAGTCTGATTTCATCTATTTCCGGAAGGGC
CCCTTCTTCGGTCTGGCCTGCTTTGCCAACATGCCGGTGGAGAGCGAGCTGGAGCGCGGCGCGCGGATGAAGTCCGTGGGCATCCTCTCTCCGTCCTACACCCTGCTCTACCGCTATATGCACTTTCT
GGAGAACCAGGTTCGACACCAGCTGGAGATGCCGGGACATTACTCTCATCTGGCTGCATTCTATGAAGACAAGAAAGGGGTGCTCCACGCTGGTCCCGGGAGGGGCGGCAGCTTGCCACCTGTCTACT
GGTTGCCTTCTATTCACCGCTACATGTATCCTGAGATGAAGATCACACACCCGGCTGGCTGCATGTCTCAGTTTATTAAGTTCTTTGGAGAACAGATCCTCATTCTTTGGAAGTTCGCCTTACTTCGA
AAGCGCATTCTGATATTTTCTCCCCCACCTGTGGGTGTCGTGTGCTATAGAGTGTACTGTTGCTGTTGTCTGGCCAATGTCTCCCTGCCTGGCATTGGGGGCACTATCCCAGAATCCAAACCTTTCTT
CTATGTGAACGTGGCTGACATTGAGAGCCTGGAAGTTGAAGTGTCCTATGTAGCCTGTACCACAGAGAAGATATTTGAGGAGAAGCGAGAGCTGTACGATGTCTATGTGGATAACCAGAATGTAAAGA
CACACCATGACCACCTGCAACCCCTGCTGAAGCTCAACAGTGCTGACCGGGAGAAGTACCGTCGGCTCAATGAGCAGAGGCAGATGCTGCTGTACTCCCAGGAGGTTGAAGGAGACTACAGCCCTTGC
GAAGAGGACCTCTTTGTGCTGTTTTTCCTAGAGCAAAACAACCGGATTTTTCAGACTCTGTTGGAGGTGTCAGCCAGCCAAGACAAAACTCTCACAGCGGAGCATGCCCGGGGCATGGGACTGGATCC
CCAGGGAGACAGGAGCTTTCTCATGGACCTGCTGGAGGCCTATGGCATCGACGTGATGCTAGTCATTGACAACCCCTGTTGTCCATAG

hide sequence

RefSeq Acc Id:

XM_006236361 ⟹ XP_006236423

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	70,163,869 - 70,195,481 (-)	NCBI
mRatBN7.2	4	69,197,161 - 69,228,785 (-)	NCBI
Rnor_6.0	4	68,569,308 - 68,597,626 (-)	NCBI
Rnor_5.0	4	133,354,586 - 133,383,909 (-)	NCBI

Sequence:

show sequence

CCGCAGCCCGCCCCGCCCCTCGCGCCCCGGCTCCGCCTCGCCTCGCCATGGTGGAGCAGGGAGACGCGGCGCCGCTTCTGCGCTGGGCCGAGGGCCCCGCGGTCTCTGTGCCGCAGGACCCCGCGTTG
CAGGCTGGAGGATGGGTCCGGGGCGGCAGTGGGGGCGGCCGAGTGGCCGCGGAAGCTCCCCGAAGGCGGGAACCCGAGGAGCCAGCTCCCCCCGAAGTGCTGCTGCAGCCCGGGCGCCTGGAGCTGGG
CGACGTAGAGGAGGACCAGGTGGTGGCCGTGTTCGTGGTCACCTTCGATCCTCGCTCCGGAAACATGGTAGAATGGTGCTTACCTCAAGATATTGACCTTGAAGGTGTCGAGTTCAAGTCTATGGCCA
GTGGGTCCCATAAGGTTCAGTCTGATTTCATCTATTTCCGGAAGGGCCCCTTCTTCGGTCTGGCCTGCTTTGCCAACATGCCGGTGGAGAGCGAGCTGGAGCGCGGCGCGCGGATGAAGTCCGTGGGC
ATCCTCTCTCCGTCCTACACCCTGCTCTACCGCTATATGCACTTTCTGGAGAACCAGGTTCGACACCAGCTGGAGATGCCGGGACATTACTCTCATCTGGCTGCATTCTATGAAGACAAGAAAGGGGT
GCTCCACGCTGGTCCCGGGAGGGGCGGCAGCTTGCCACCTGTCTACTGGTTGCCTTCTATTCACCGCTACATGTATCCTGAGATGAAGATCACACACCCGGCTGGCTGCATGTCTCAGTTTATTAAGT
TCTTTGGAGAACAGATCCTCATTCTTTGGAAGTTCGCCTTACTTCGAAAGCGCATTCTGATATTTTCTCCCCCACCTGTGGGTGTCGTGTGCTATAGAGTGTACTGTTGCTGTTGTCTGGCCAATGTC
TCCCTGCCTGGCATTGGGGGCACTATCCCAGAATCCAAACCTTTCTTCTATGTGAACGTGGCTGACATTGAGAGCCTGGAAGTTGAAGTGTCCTATGTAGCCTGTACCACAGAGAAGATATTTGAGGA
GAAGCGAGAGCTGTACGATGTCTATGTGGATAACCAGAATGTAAAGACACACCATGACCACCTGCAACCCCTGCTGAAGCTCAACAGTGCTGACCGGGAGAAGTACCGTCGGCTCAATGAGCAGAGGC
AGATGCTGCTGTACTCCCAGGAAGTTGAAGGAGACTACAGCCCTTGCGAAGAGGACCTCTTTGTGCTGTTTTTCCTAGAGCAAAACAACCGGATTTTTCAGACTCTGTTGGAGGTGTCAGCCAGCCAA
GACAAAACTCTCACAGCGGAGCATGCCCGGGGCATGGGACTGGATCCCCAGGGAGACAGGAGCTTTCTCATGGACCTGCTGGAGGCCTATGGCATCGACGTGATGCTAGTCATTGACAACCCCTGTTG
TCCATAGATGTTCATCTGCCTAAAAACAGAAACTAATCAGATGACCTTTCAAGTTCACCAAGTTCAAGGAGTCAAGTTGGGATCACCTATTCATCAGAGGACAAGTCTGCACCTTCTTGGTTCGCTGG
AGTAGAGGGACCACGAAGACGAAGAAAAAAAGTGTCTCTGATAGAATGGCAGGGAAAGAATCCTTGAAATGCTTCCTAAAATAAGGGA

hide sequence

RefSeq Acc Id:

XM_039107528 ⟹ XP_038963456

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	70,163,869 - 70,232,731 (-)	NCBI
mRatBN7.2	4	69,197,161 - 69,266,013 (-)	NCBI


Protein RefSeqs	NP_001038166	(Get FASTA)	NCBI Sequence Viewer
	XP_006236423	(Get FASTA)	NCBI Sequence Viewer
	XP_038963456	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABH04324	(Get FASTA)	NCBI Sequence Viewer
	EDM15407	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015921
	ENSRNOP00000015921.4
GenBank Protein	Q0PGW2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001038166 ⟸ NM_001044701

- UniProtKB:

Q0PGW2 (UniProtKB/Swiss-Prot), A6IEX0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVEQGDAAPLLRWAEGPAVSVPQDPALQAGGWVRGGSGGGRVAAEAPRRREPEEPAPPEVLLQPGRLELGDVEEDQVVAVFVVTFDPRSGNMVEWCLPQDIDLEGVEFKSMASGSHKVQSDFIYFRKG
PFFGLACFANMPVESELERGARMKSVGILSPSYTLLYRYMHFLENQVRHQLEMPGHYSHLAAFYEDKKGVLHAGPGRGGSLPPVYWLPSIHRYMYPEMKITHPAGCMSQFIKFFGEQILILWKFALLR
KRILIFSPPPVGVVCYRVYCCCCLANVSLPGIGGTIPESKPFFYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKLNSADREKYRRLNEQRQMLLYSQEVEGDYSPC
EEDLFVLFFLEQNNRIFQTLLEVSASQDKTLTAEHARGMGLDPQGDRSFLMDLLEAYGIDVMLVIDNPCCP

hide sequence

RefSeq Acc Id:	XP_006236423 ⟸ XM_006236361
- Peptide Label:	isoform X1
- UniProtKB:	Q0PGW2 (UniProtKB/Swiss-Prot), A6IEX0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVEQGDAAPLLRWAEGPAVSVPQDPALQAGGWVRGGSGGGRVAAEAPRRREPEEPAPPEVLLQPGRLELGDVEEDQVVAVFVVTFDPRSGNMVEWCLPQDIDLEGVEFKSMASGSHKVQSDFIYFRKG PFFGLACFANMPVESELERGARMKSVGILSPSYTLLYRYMHFLENQVRHQLEMPGHYSHLAAFYEDKKGVLHAGPGRGGSLPPVYWLPSIHRYMYPEMKITHPAGCMSQFIKFFGEQILILWKFALLR KRILIFSPPPVGVVCYRVYCCCCLANVSLPGIGGTIPESKPFFYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKLNSADREKYRRLNEQRQMLLYSQEVEGDYSPC EEDLFVLFFLEQNNRIFQTLLEVSASQDKTLTAEHARGMGLDPQGDRSFLMDLLEAYGIDVMLVIDNPCCP hide sequence

Ensembl Acc Id:

ENSRNOP00000015921 ⟸ ENSRNOT00000015921

RefSeq Acc Id:	XP_038963456 ⟸ XM_039107528
- Peptide Label:	isoform X2

Protein Domains

cDENN dDENN uDENN

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q0PGW2-F1-model_v2	AlphaFold	Q0PGW2	1-455	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692985

Promoter ID:

EPDNEW_R3510

Type:

multiple initiation site

Name:

RGD1563986_1

Description:

similar to RIKEN cDNA E330009J07 gene

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	68,597,587 - 68,597,647	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-45166	BioCyc
Ensembl Genes	ENSRNOG00000011854	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015921	ENTREZGENE
	ENSRNOT00000015921.7	UniProtKB/Swiss-Prot
InterPro	DENND11/AVL9_GEFs	UniProtKB/Swiss-Prot
	LCHN/Anr2	UniProtKB/Swiss-Prot
	Tripartite_DENN	UniProtKB/Swiss-Prot
KEGG Report	rno:312270	UniProtKB/Swiss-Prot
NCBI Gene	312270	ENTREZGENE
PANTHER	DENN DOMAIN-CONTAINING PROTEIN 11	UniProtKB/Swiss-Prot
	LATE SECRETORY PATHWAY PROTEIN AVL9-RELATED	UniProtKB/Swiss-Prot
Pfam	DUF2347	UniProtKB/Swiss-Prot
PhenoGen	Dennd11	PhenoGen
PROSITE	DENN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011854	RatGTEx
UniProt	A6IEX0	ENTREZGENE, UniProtKB/TrEMBL
	LCHN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-09	Dennd11	DENN domain containing 11	RGD1563986	similar to RIKEN cDNA E330009J07 gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1563986	similar to RIKEN cDNA E330009J07 gene	RGD1563986_predicted	similar to RIKEN cDNA E330009J07 gene (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1563986_predicted	similar to RIKEN cDNA E330009J07 gene (predicted)	LOC312270	similar to RIKEN cDNA E330009J07 gene	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC312270	similar to RIKEN cDNA E330009J07 gene			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar