Symbol:
Wtap
Name:
WT1 associated protein
RGD ID:
1563824
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in mRNA processing and regulation of alternative mRNA splicing, via spliceosome. Predicted to be located in cytoplasm; nuclear membrane; and nuclear speck. Predicted to be part of RNA N6-methyladenosine methyltransferase complex. Predicted to be active in nucleus. Orthologous to human WTAP (WT1 associated protein); INTERACTS WITH amitrole; bisphenol A; cadmium dichloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC499020; pre-mRNA-splicing regulator WTAP; RGD1563824; similar to Wilms tumor 1-associating protein (WT1-associated protein) (Putative pre-mRNA splicing regulator female-lethal(2D) homolog); similar to Wilms tumor 1-associating protein (WT1-associated protein) homolog); Wilms tumor 1 associated protein; Wilms' tumour 1-associating protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WTAP (WT1 associated protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Wtap (WT1 associating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wtap (WT1 associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WTAP (WT1 associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WTAP (WT1 associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wtap (WT1 associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WTAP (WT1 associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WTAP (WT1 associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wtap (WT1 associated protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NLRP3 (NLR family pyrin domain containing 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
WTAP (WT1 associated protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Wtap (WT1 associating protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wtap (WT1 associated protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
fl(2)d
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
wtap
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,070,973 - 50,096,074 (+) NCBI GRCr8 mRatBN7.2 1 47,665,965 - 47,691,067 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,665,965 - 47,691,065 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,214,813 - 48,239,914 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,202,806 - 54,227,929 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,290,329 - 48,315,430 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 47,942,500 - 47,967,633 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 47,942,500 - 47,967,631 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,781,701 - 51,806,726 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 41,891,437 - 41,917,254 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 43,351,111 - 43,376,211 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wtap Rat 1,2-dichloroethane increases expression ISO RGD:1321462 6480464 ethylene dichloride results in increased expression of WTAP mRNA CTD PMID:28960355 Wtap Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1321462 6480464 1,2-Dimethylhydrazine results in decreased expression of WTAP mRNA CTD PMID:22206623 Wtap Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1321462 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of WTAP mRNA CTD PMID:31388691 Wtap Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1321462 6480464 Tetrachlorodibenzodioxin results in increased expression of WTAP mRNA CTD PMID:21354282 Wtap Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1321462 6480464 Tetrachlorodibenzodioxin affects the expression of WTAP mRNA CTD PMID:24680724 Wtap Rat 2,4,6-tribromophenol increases expression ISO RGD:1321462 6480464 2,4,6-tribromophenol results in increased expression of WTAP mRNA; 2,4,6-tribromophenol results in increased expression of WTAP more ... CTD PMID:38157273 Wtap Rat 2,4,6-tribromophenol increases expression ISO RGD:1321461 6480464 2,4,6-tribromophenol results in increased expression of WTAP mRNA CTD PMID:38157273 Wtap Rat 2,4,6-trichlorophenol increases expression ISO RGD:1321462 6480464 2,4,6-trichlorophenol results in increased expression of WTAP mRNA; 2,4,6-trichlorophenol results in increased expression of WTAP more ... CTD PMID:38157273 Wtap Rat 5-fluorouracil multiple interactions ISO RGD:1321461 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of WTAP mRNA] CTD PMID:15016801 Wtap Rat all-trans-retinoic acid increases expression ISO RGD:1321461 6480464 Tretinoin results in increased expression of WTAP mRNA CTD PMID:23724009 Wtap Rat amiodarone increases expression ISO RGD:1321461 6480464 Amiodarone results in increased expression of WTAP mRNA CTD PMID:19774075 Wtap Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of WTAP mRNA CTD PMID:38685447 Wtap Rat antirheumatic drug decreases expression ISO RGD:1321461 6480464 Antirheumatic Agents results in decreased expression of WTAP mRNA CTD PMID:24449571 Wtap Rat Aroclor 1254 decreases expression ISO RGD:1321462 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of WTAP mRNA CTD PMID:23650126 Wtap Rat arsane increases expression ISO RGD:1321461 6480464 Arsenic results in increased expression of WTAP CTD PMID:35363433 Wtap Rat arsenic atom increases expression ISO RGD:1321461 6480464 Arsenic results in increased expression of WTAP CTD PMID:35363433 Wtap Rat benzo[a]pyrene increases expression ISO RGD:1321461 6480464 Benzo(a)pyrene results in increased expression of WTAP mRNA CTD PMID:17879257 Wtap Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1321461 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of WTAP mRNA CTD PMID:20018196 Wtap Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1321462 6480464 Diethylhexyl Phthalate results in increased expression of WTAP mRNA CTD PMID:36423848 Wtap Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of WTAP mRNA CTD PMID:25181051 Wtap Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of WTAP protein CTD PMID:37495067 Wtap Rat bisphenol A increases expression ISO RGD:1321461 6480464 bisphenol A results in increased expression of WTAP protein CTD PMID:34186270 Wtap Rat bisphenol AF increases expression ISO RGD:1321461 6480464 bisphenol AF results in increased expression of WTAP protein CTD PMID:34186270 Wtap Rat bisphenol F increases expression ISO RGD:1321461 6480464 bisphenol F results in increased expression of WTAP protein CTD PMID:34186270 Wtap Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of WTAP mRNA CTD PMID:33453195 Wtap Rat cadmium dichloride decreases expression ISO RGD:1321461 6480464 Cadmium Chloride results in decreased expression of WTAP mRNA CTD PMID:38568856 Wtap Rat cadmium dichloride increases expression ISO RGD:1321461 6480464 Cadmium Chloride results in increased expression of WTAP mRNA CTD PMID:26472689 Wtap Rat casticin decreases expression ISO RGD:1321462 6480464 casticin results in decreased expression of WTAP mRNA CTD PMID:28444820 Wtap Rat CGP 52608 multiple interactions ISO RGD:1321461 6480464 CGP 52608 promotes the reaction [RORA protein binds to WTAP gene] CTD PMID:28238834 Wtap Rat clobetasol decreases expression ISO RGD:1321462 6480464 Clobetasol results in decreased expression of WTAP mRNA CTD PMID:27462272 Wtap Rat cobalt atom decreases expression ISO RGD:1321462 6480464 Cobalt results in decreased expression of WTAP protein CTD PMID:32827984 Wtap Rat cobalt atom affects expression ISO RGD:1321462 6480464 Cobalt affects the expression of WTAP mRNA CTD PMID:32827984 Wtap Rat cobalt atom increases expression ISO RGD:1321461 6480464 Cobalt results in increased expression of WTAP mRNA; Cobalt results in increased expression of WTAP more ... CTD PMID:32827984 Wtap Rat crocidolite asbestos affects expression ISO RGD:1321461 6480464 Asbestos, Crocidolite affects the expression of WTAP mRNA CTD PMID:25757056 Wtap Rat crocidolite asbestos decreases expression ISO RGD:1321462 6480464 Asbestos, Crocidolite results in decreased expression of WTAP mRNA CTD PMID:29279043 Wtap Rat cyclosporin A increases expression ISO RGD:1321461 6480464 Cyclosporine results in increased expression of WTAP mRNA CTD PMID:20106945 Wtap Rat disodium selenite increases expression ISO RGD:1321461 6480464 Sodium Selenite results in increased expression of WTAP mRNA CTD PMID:18175754 Wtap Rat enzyme inhibitor multiple interactions ISO RGD:1321461 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Wtap Rat ethanol increases expression ISO RGD:1321462 6480464 Ethanol results in increased expression of WTAP mRNA CTD PMID:30319688 Wtap Rat ethanol affects splicing ISO RGD:1321462 6480464 Ethanol affects the splicing of WTAP mRNA CTD PMID:30319688 Wtap Rat folic acid decreases expression ISO RGD:1321462 6480464 Folic Acid results in decreased expression of WTAP mRNA CTD PMID:25629700 Wtap Rat formaldehyde increases expression ISO RGD:1321461 6480464 Formaldehyde results in increased expression of WTAP mRNA CTD PMID:20655997 Wtap Rat FR900359 affects phosphorylation ISO RGD:1321461 6480464 FR900359 affects the phosphorylation of WTAP protein CTD PMID:37730182 Wtap Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of WTAP mRNA CTD PMID:22061828 Wtap Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of WTAP mRNA CTD PMID:33387578 Wtap Rat hydrogen peroxide multiple interactions ISO RGD:1321461 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of WTAP protein CTD PMID:18951874 Wtap Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of WTAP mRNA CTD PMID:20080153 Wtap Rat lipopolysaccharide increases expression ISO RGD:1321461 6480464 Lipopolysaccharides results in increased expression of WTAP mRNA CTD PMID:35811015 Wtap Rat lipopolysaccharide multiple interactions ISO RGD:1321461 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of WTAP mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Wtap Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of WTAP mRNA CTD PMID:38685447 Wtap Rat methyl methanesulfonate decreases expression ISO RGD:1321461 6480464 Methyl Methanesulfonate results in decreased expression of WTAP mRNA CTD PMID:23649840 Wtap Rat miconazole decreases expression ISO RGD:1321462 6480464 Miconazole results in decreased expression of WTAP mRNA CTD PMID:27462272 Wtap Rat mitomycin C affects response to substance ISO RGD:1321461 6480464 WTAP protein affects the susceptibility to Mitomycin CTD PMID:16217747 Wtap Rat mono(2-ethylhexyl) phthalate increases expression ISO RGD:1321462 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of WTAP mRNA CTD PMID:36174712 Wtap Rat N-acetyl-L-cysteine multiple interactions ISO RGD:1321461 6480464 Acetylcysteine inhibits the reaction [sodium arsenite results in increased expression of WTAP mRNA]; Acetylcysteine inhibits more ... CTD PMID:31004932 Wtap Rat nickel sulfate decreases expression ISO RGD:1321461 6480464 nickel sulfate results in decreased expression of WTAP mRNA CTD PMID:22714537 Wtap Rat paracetamol affects expression ISO RGD:1321462 6480464 Acetaminophen affects the expression of WTAP mRNA CTD PMID:17562736 Wtap Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of WTAP mRNA CTD PMID:33387578 Wtap Rat pentachlorophenol increases expression ISO RGD:1321462 6480464 Pentachlorophenol results in increased expression of WTAP mRNA CTD PMID:23892564 Wtap Rat PhIP decreases expression ISO RGD:1321461 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in decreased expression of WTAP mRNA CTD PMID:20816883 Wtap Rat pirinixic acid decreases expression ISO RGD:1321462 6480464 pirinixic acid results in decreased expression of WTAP mRNA CTD PMID:17426115 Wtap Rat poly(I:C) multiple interactions ISO RGD:1321461 6480464 [TL8-506 co-treated with Poly I-C] results in increased expression of WTAP mRNA CTD PMID:35688559 Wtap Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1321461 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of WTAP mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Wtap Rat sodium arsenite decreases expression ISO RGD:1321461 6480464 sodium arsenite results in decreased expression of WTAP mRNA CTD PMID:22714537|PMID:29301061|PMID:38568856 Wtap Rat sodium arsenite increases expression ISO RGD:1321461 6480464 sodium arsenite results in increased expression of WTAP mRNA; sodium arsenite results in increased expression more ... CTD PMID:31004932 Wtap Rat sodium arsenite multiple interactions ISO RGD:1321461 6480464 Acetylcysteine inhibits the reaction [sodium arsenite results in increased expression of WTAP mRNA]; Acetylcysteine inhibits more ... CTD PMID:31004932 Wtap Rat sodium arsenite affects expression ISO RGD:1321461 6480464 sodium arsenite affects the expression of WTAP mRNA; sodium arsenite affects the expression of WTAP more ... CTD PMID:29680375|PMID:30654086 Wtap Rat sodium arsenite increases expression ISO RGD:1321462 6480464 sodium arsenite results in increased expression of WTAP protein CTD PMID:37061066 Wtap Rat sunitinib increases expression ISO RGD:1321461 6480464 Sunitinib results in increased expression of WTAP mRNA CTD PMID:31533062 Wtap Rat tamoxifen increases expression ISO RGD:1321461 6480464 Tamoxifen results in increased expression of WTAP mRNA CTD PMID:15604281 Wtap Rat temozolomide increases expression ISO RGD:1321461 6480464 Temozolomide results in increased expression of WTAP mRNA CTD PMID:31758290 Wtap Rat theophylline multiple interactions ISO RGD:1321461 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of WTAP protein CTD PMID:18951874 Wtap Rat thiram decreases expression ISO RGD:1321461 6480464 Thiram results in decreased expression of WTAP mRNA CTD PMID:38568856 Wtap Rat titanium dioxide decreases methylation ISO RGD:1321462 6480464 titanium dioxide results in decreased methylation of WTAP promoter CTD PMID:35295148 Wtap Rat triphenyl phosphate affects expression ISO RGD:1321461 6480464 triphenyl phosphate affects the expression of WTAP mRNA CTD PMID:37042841 Wtap Rat valproic acid decreases methylation ISO RGD:1321461 6480464 Valproic Acid results in decreased methylation of WTAP gene CTD PMID:29154799 Wtap Rat valproic acid affects expression ISO RGD:1321462 6480464 Valproic Acid affects the expression of WTAP mRNA CTD PMID:17963808 Wtap Rat valproic acid decreases expression ISO RGD:1321462 6480464 Valproic Acid results in decreased expression of WTAP mRNA CTD PMID:20546886 Wtap Rat valproic acid affects expression ISO RGD:1321461 6480464 Valproic Acid affects the expression of WTAP mRNA CTD PMID:25979313 Wtap Rat valproic acid decreases expression ISO RGD:1321461 6480464 Valproic Acid results in decreased expression of WTAP mRNA CTD PMID:23179753|PMID:24383497|PMID:27188386 Wtap Rat zoledronic acid increases expression ISO RGD:1321461 6480464 zoledronic acid results in increased expression of WTAP mRNA CTD PMID:24714768
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,4,6-trichlorophenol (ISO) 5-fluorouracil (ISO) all-trans-retinoic acid (ISO) amiodarone (ISO) amitrole (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) casticin (ISO) CGP 52608 (ISO) clobetasol (ISO) cobalt atom (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) disodium selenite (ISO) enzyme inhibitor (ISO) ethanol (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) hydrogen peroxide (ISO) ketamine (EXP) lipopolysaccharide (ISO) methimazole (EXP) methyl methanesulfonate (ISO) miconazole (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (ISO) nickel sulfate (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) PhIP (ISO) pirinixic acid (ISO) poly(I:C) (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) theophylline (ISO) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zoledronic acid (ISO)
Wtap Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 50,070,973 - 50,096,074 (+) NCBI GRCr8 mRatBN7.2 1 47,665,965 - 47,691,067 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 47,665,965 - 47,691,065 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 48,214,813 - 48,239,914 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 54,202,806 - 54,227,929 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 48,290,329 - 48,315,430 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 47,942,500 - 47,967,633 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 47,942,500 - 47,967,631 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 51,781,701 - 51,806,726 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 41,891,437 - 41,917,254 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 43,351,111 - 43,376,211 (+) NCBI Celera Cytogenetic Map 1 q11 NCBI
WTAP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 159,726,693 - 159,756,319 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 159,725,585 - 159,756,319 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 160,148,149 - 160,177,351 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 160,068,142 - 160,097,341 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 160,794,229 - 160,823,430 (+) NCBI Celera Cytogenetic Map 6 q25.3 NCBI HuRef 6 157,617,339 - 157,646,781 (+) NCBI HuRef CHM1_1 6 160,410,378 - 160,439,680 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 160,967,457 - 161,001,943 (+) NCBI T2T-CHM13v2.0
Wtap Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 13,185,686 - 13,211,430 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 13,185,683 - 13,213,056 (-) Ensembl GRCm39 Ensembl GRCm38 17 12,966,799 - 12,992,543 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 12,966,796 - 12,994,169 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 13,159,665 - 13,185,405 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 12,815,617 - 12,835,478 (-) NCBI MGSCv36 mm8 Celera 17 12,998,333 - 13,025,542 (-) NCBI Celera Cytogenetic Map 17 A1 NCBI cM Map 17 8.73 NCBI
Wtap Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 21,146,206 - 21,182,486 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 21,149,970 - 21,174,479 (-) NCBI ChiLan1.0 ChiLan1.0
WTAP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 179,824,106 - 179,854,540 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 177,729,160 - 177,759,590 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 157,609,779 - 157,639,122 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 162,620,947 - 162,650,683 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 162,621,842 - 162,650,683 (+) Ensembl panpan1.1 panPan2
WTAP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 48,976,523 - 49,004,536 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 48,976,499 - 49,003,961 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 49,818,344 - 49,846,503 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 49,160,699 - 49,189,019 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 49,160,693 - 49,189,019 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 49,043,176 - 49,071,381 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 48,914,192 - 48,942,472 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 49,529,308 - 49,557,423 (+) NCBI UU_Cfam_GSD_1.0 UU_Cfam_GSD_1.0 1 49,480,343 - 49,508,532 (+) NCBI UU_Cfam_GSD_1.0
Wtap Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 143,966,743 - 143,997,439 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 11,227,156 - 11,249,818 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 11,222,513 - 11,249,432 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WTAP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 7,622,547 - 7,651,961 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 7,622,544 - 7,651,732 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 9,419,861 - 9,447,657 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WTAP
Wtap
.
Predicted Target Of
Count of predictions: 139 Count of miRNA genes: 115 Interacting mature miRNAs: 121 Transcripts: ENSRNOT00000025936 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1357397 Bw41 Body weight QTL 41 4.19 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 1357401 Bw43 Body weight QTL 43 3.75 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 631494 Bp95 Blood pressure QTL 95 40 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 16206210 49268520 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 5684998 Bss101 Bone structure and strength QTL 101 3.6 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 1 15431621 49361612 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 5684999 Bss102 Bone structure and strength QTL 102 5.5 7e-07 tibia strength trait (VT:1000284) tibia stiffness (CMO:0001735) 1 15431621 49361612 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 724520 Bp145 Blood pressure QTL 145 2.1 0.0024 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 20784828 65784828 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
RH142762
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 47,686,302 - 47,686,588 (+) MAPPER mRatBN7.2 Rnor_6.0 1 47,962,869 - 47,963,154 NCBI Rnor6.0 Rnor_5.0 1 51,786,180 - 51,786,465 UniSTS Rnor5.0 RGSC_v3.4 1 41,912,490 - 41,912,775 UniSTS RGSC3.4 Celera 1 43,371,446 - 43,371,731 UniSTS RH 3.4 Map 1 565.8 UniSTS Cytogenetic Map 1 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025936 ⟹ ENSRNOP00000025936
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,665,965 - 47,691,065 (+) Ensembl Rnor_6.0 Ensembl 1 47,942,500 - 47,967,631 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079312 ⟹ ENSRNOP00000072376
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,666,248 - 47,683,840 (+) Ensembl Rnor_6.0 Ensembl 1 47,942,800 - 47,959,694 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102248 ⟹ ENSRNOP00000077397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 47,672,470 - 47,691,065 (+) Ensembl
RefSeq Acc Id:
NM_001113542 ⟹ NP_001107014
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,070,973 - 50,096,074 (+) NCBI mRatBN7.2 1 47,665,965 - 47,691,067 (+) NCBI Rnor_6.0 1 47,942,500 - 47,967,633 (+) NCBI Rnor_5.0 1 51,781,701 - 51,806,726 (-) NCBI RGSC_v3.4 1 41,891,437 - 41,917,254 (+) RGD Celera 1 43,351,111 - 43,376,211 (+) RGD
Sequence:
CCGGCTAAGCTTGCAGAGCCCCCACGGGGCAGGTGCGAACCTCCGCGGACGGTCTCGGTGCGGCTGCGGAGAGCCGCTTGCCCCTCCGCGCCCCGAGACCCCGAGCGGGCCGGCCTCGCCTCGTCTCT
hide sequence
RefSeq Acc Id:
NM_001113543 ⟹ NP_001107015
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,070,973 - 50,088,138 (+) NCBI mRatBN7.2 1 47,665,965 - 47,683,131 (+) NCBI Rnor_6.0 1 47,942,500 - 47,959,697 (+) NCBI Rnor_5.0 1 51,781,701 - 51,806,726 (-) NCBI RGSC_v3.4 1 41,891,437 - 41,917,254 (+) RGD Celera 1 43,351,111 - 43,368,274 (+) NCBI
Sequence:
CCGGCTAAGCTTGCAGAGCCCCCACGGGGCAGGTGCGAACCTCCGCGGACGGTCTCGGTGCGGCTGCGGAGAGCCGCTTGCCCCTCCGCGCCCCGAGACCCCGAGCGGGCCGGCCTCGCCTCGTCTCT
hide sequence
RefSeq Acc Id:
NM_001113544 ⟹ NP_001107016
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,071,273 - 50,088,138 (+) NCBI mRatBN7.2 1 47,666,265 - 47,683,131 (+) NCBI Rnor_6.0 1 47,942,800 - 47,959,697 (+) NCBI Rnor_5.0 1 51,781,701 - 51,806,726 (-) NCBI RGSC_v3.4 1 41,891,437 - 41,917,254 (+) RGD Celera 1 43,351,411 - 43,368,274 (+) NCBI
Sequence:
AGACCCGCAAATAAAGGCTATCTCCGGGGCTGCGGCGGGAGGAGTGCGGGGGGGGGCCGGCGGC
hide sequence
RefSeq Acc Id:
XM_006227892 ⟹ XP_006227954
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,071,258 - 50,096,074 (+) NCBI mRatBN7.2 1 47,666,252 - 47,691,067 (+) NCBI Rnor_6.0 1 47,942,755 - 47,967,633 (+) NCBI Rnor_5.0 1 51,781,701 - 51,806,726 (-) NCBI
Sequence:
ACGGCGGGGCCTGGTTTCCTCCCTCAGCGCCATTTTGTGGCTGCGAGACCCGCAAATAAAGGCT
hide sequence
RefSeq Acc Id:
XM_006227893 ⟹ XP_006227955
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,071,434 - 50,096,074 (+) NCBI mRatBN7.2 1 47,666,605 - 47,691,067 (+) NCBI Rnor_6.0 1 47,942,925 - 47,967,633 (+) NCBI Rnor_5.0 1 51,781,701 - 51,806,726 (-) NCBI
Sequence:
GCGGCCCGCGGCGGGAATGGCCACGAGGGCCTGCAGGGACGGGAAGCGAGGCGCGGCCGCCCTG
hide sequence
RefSeq Acc Id:
XM_039086890 ⟹ XP_038942818
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,088,454 - 50,096,074 (+) NCBI mRatBN7.2 1 47,682,112 - 47,691,067 (+) NCBI
RefSeq Acc Id:
XM_039086893 ⟹ XP_038942821
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,087,183 - 50,096,074 (+) NCBI mRatBN7.2 1 47,682,112 - 47,691,067 (+) NCBI
RefSeq Acc Id:
XM_039086894 ⟹ XP_038942822
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,071,258 - 50,088,138 (+) NCBI mRatBN7.2 1 47,666,252 - 47,683,133 (+) NCBI
RefSeq Acc Id:
XM_063270739 ⟹ XP_063126809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,071,024 - 50,088,138 (+) NCBI
RefSeq Acc Id:
XM_063270747 ⟹ XP_063126817
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 50,071,518 - 50,088,138 (+) NCBI
RefSeq Acc Id:
NP_001107014 ⟸ NM_001113542
- Peptide Label:
isoform a
- UniProtKB:
D3ZPY0 (UniProtKB/TrEMBL), A0A8I5XW36 (UniProtKB/TrEMBL)
- Sequence:
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGEL
hide sequence
RefSeq Acc Id:
NP_001107015 ⟸ NM_001113543
- Peptide Label:
isoform b
- UniProtKB:
A0A0G2K2U2 (UniProtKB/TrEMBL), A6KP27 (UniProtKB/TrEMBL)
- Sequence:
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQ
hide sequence
RefSeq Acc Id:
NP_001107016 ⟸ NM_001113544
- Peptide Label:
isoform b
- UniProtKB:
A0A0G2K2U2 (UniProtKB/TrEMBL), A6KP27 (UniProtKB/TrEMBL)
- Sequence:
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGEL
hide sequence
RefSeq Acc Id:
XP_006227954 ⟸ XM_006227892
- Peptide Label:
isoform X1
- UniProtKB:
D3ZPY0 (UniProtKB/TrEMBL), A0A8I5XW36 (UniProtKB/TrEMBL)
- Sequence:
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQ
hide sequence
RefSeq Acc Id:
XP_006227955 ⟸ XM_006227893
- Peptide Label:
isoform X1
- UniProtKB:
D3ZPY0 (UniProtKB/TrEMBL), A0A8I5XW36 (UniProtKB/TrEMBL)
- Sequence:
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGEL
hide sequence
Ensembl Acc Id:
ENSRNOP00000072376 ⟸ ENSRNOT00000079312
Ensembl Acc Id:
ENSRNOP00000025936 ⟸ ENSRNOT00000025936
RefSeq Acc Id:
XP_038942822 ⟸ XM_039086894
- Peptide Label:
isoform X3
- UniProtKB:
A6KP27 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942818 ⟸ XM_039086890
- Peptide Label:
isoform X2
- UniProtKB:
A6KP29 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942821 ⟸ XM_039086893
- Peptide Label:
isoform X2
- UniProtKB:
A6KP29 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000077397 ⟸ ENSRNOT00000102248
RefSeq Acc Id:
XP_063126809 ⟸ XM_063270739
- Peptide Label:
isoform X3
- UniProtKB:
A6KP27 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063126817 ⟸ XM_063270747
- Peptide Label:
isoform X3
- UniProtKB:
A6KP27 (UniProtKB/TrEMBL)
RGD ID: 13689612 Promoter ID: EPDNEW_R136 Type: initiation region Name: Wtap_2 Description: WT1 associated protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R137 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 47,942,502 - 47,942,562 EPDNEW
RGD ID: 13689613 Promoter ID: EPDNEW_R137 Type: multiple initiation site Name: Wtap_1 Description: WT1 associated protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R136 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 47,942,783 - 47,942,843 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-21
Wtap
WT1 associated protein
Wtap
Wilms tumor 1 associated protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-23
Wtap
Wilms tumor 1 associated protein
Wtap
Wilms' tumour 1-associating protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Wtap
Wilms' tumour 1-associating protein
RGD1563824_predicted
similar to Wilms tumor 1-associating protein (WT1-associated protein) homolog) (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-10
RGD1563824_predicted
similar to Wilms tumor 1-associating protein (WT1-associated protein) homolog) (predicted)
similar to Wilms tumor 1-associating protein (WT1-associated protein) (Putative pre-mRNA splicing regulator female-lethal(2D) homolog) (predicted)
Name updated
1299863 APPROVED
2006-03-07
RGD1563824_predicted
similar to Wilms tumor 1-associating protein (WT1-associated protein) (Putative pre-mRNA splicing regulator female-lethal(2D) homolog) (predicted)
LOC499020
similar to Wilms tumor 1-associating protein (WT1-associated protein) (Putative pre-mRNA splicing regulator female-lethal(2D) homolog)
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC499020
similar to Wilms tumor 1-associating protein (WT1-associated protein) (Putative pre-mRNA splicing regulator female-lethal(2D) homolog)
Symbol and Name status set to provisional
70820 PROVISIONAL
