Scd4 (stearoyl-coenzyme A desaturase 4)

Advanced Search (OLGA)

Gene: Scd4 (stearoyl-coenzyme A desaturase 4) Rattus norvegicus

Analyze

Symbol:

Scd4

Name:

stearoyl-coenzyme A desaturase 4

RGD ID:

1563648

Description:

Predicted to enable iron ion binding activity; palmitoyl-CoA 9-desaturase activity; and stearoyl-CoA 9-desaturase activity. Predicted to be involved in cellular response to nutrient; fatty acid biosynthetic process; and response to fatty acid. Predicted to act upstream of or within fatty acid biosynthetic process. Predicted to be located in membrane. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human SCD (stearoyl-CoA desaturase); PARTICIPATES IN eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; unsaturated fatty acid biosynthetic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

acyl-CoA desaturase 4; LOC499358; RGD1563648; similar to stearoyl-CoA desaturase-4; stearoyl-CoA desaturase 4

RGD Orthologs

Mouse

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Scd4 (stearoyl-coenzyme A desaturase 4)	RGD	RGD
Other homologs ²
Homo sapiens (human):	SCD (stearoyl-CoA desaturase)	HGNC	Ensembl, OrthoDB, Panther, Treefam
Homo sapiens (human):	KAT2A (lysine acetyltransferase 2A)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SCD (stearoyl-CoA desaturase)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Scd4 (stearoyl-coenzyme A desaturase 4)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	scdb (stearoyl-CoA desaturase b)	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	scd (stearoyl-CoA desaturase (delta-9-desaturase))	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG15531	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	OLE1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fat-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fat-7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8630	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG9743	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG9747	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Desat1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Desat2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fad2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fat-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	scd	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	253,152,519 - 253,165,216 (+)	NCBI		GRCr8
mRatBN7.2	1	243,203,433 - 243,216,007 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	243,203,881 - 243,215,148 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	264,094,007 - 264,105,473 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	264,094,080 - 264,105,344 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	271,536,899 - 271,548,370 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	249,392,727 - 249,404,075 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	239,018,702 - 239,030,168 (+)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

atrazine (EXP)

bisphenol A (EXP)

bisphenol F (ISO)

Cuprizon (EXP)

doxorubicin (EXP)

endosulfan (EXP)

flutamide (EXP)

manganese(II) chloride (EXP)

methimazole (EXP)

Monobutylphthalate (EXP)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (EXP)

rotenone (EXP)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (EXP)

titanium dioxide (EXP)

trichloroethene (EXP)

trovafloxacin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to nutrient (ISO)

fatty acid biosynthetic process (ISO)

monounsaturated fatty acid biosynthetic process (IBA,ISO)

response to fatty acid (IBA)

unsaturated fatty acid biosynthetic process (IBA)

Cellular Component

endoplasmic reticulum membrane (IBA)

membrane (ISO)

Molecular Function

iron ion binding (IBA)

palmitoyl-CoA 9-desaturase activity (IBA,ISO)

stearoyl-CoA 9-desaturase activity (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma (IEA)

unsaturated fatty acid biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12815040	PMID:16443825

Genomics

Comparative Map Data

Scd4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	253,152,519 - 253,165,216 (+)	NCBI		GRCr8
mRatBN7.2	1	243,203,433 - 243,216,007 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	243,203,881 - 243,215,148 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	264,094,007 - 264,105,473 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	264,094,080 - 264,105,344 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	271,536,899 - 271,548,370 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	249,392,727 - 249,404,075 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	239,018,702 - 239,030,168 (+)	NCBI		Celera
Cytogenetic Map	1	q54	NCBI

Scd4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	44,321,765 - 44,335,182 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	44,321,531 - 44,335,182 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	44,333,326 - 44,346,743 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	44,333,092 - 44,346,743 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	44,407,816 - 44,421,233 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	44,386,637 - 44,400,054 (+)	NCBI		MGSCv36	mm8
Celera	19	45,107,480 - 45,120,860 (+)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	37.98	NCBI

Variants

Variants in Scd4
169 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	139
Count of miRNA genes:	110
Interacting mature miRNAs:	122
Transcripts:	ENSRNOT00000017834, ENSRNOT00000047602
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
631690	Scl5	Serum cholesterol level QTL 5	2.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	236125214	260522016	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	238699859	259647894	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	237147813	260522016	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	232156370	259647894	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	233948574	260522016	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233190394	258625266	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	9	30	78	61	57	31	22	31	6	165	75	58	45	56	26

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_001057317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_574671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC105487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017834 ⟹ ENSRNOP00000017834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	243,203,881 - 243,215,148 (+)	Ensembl
Rnor_6.0 Ensembl	1	264,094,080 - 264,105,344 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000047602 ⟹ ENSRNOP00000046035

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	264,094,080 - 264,094,920 (+)	Ensembl

RefSeq Acc Id:

XM_574671 ⟹ XP_574671

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	253,152,519 - 253,165,216 (+)	NCBI
mRatBN7.2	1	243,203,433 - 243,216,007 (+)	NCBI
Rnor_6.0	1	264,094,007 - 264,105,473 (+)	NCBI
Rnor_5.0	1	271,536,899 - 271,548,370 (+)	NCBI
RGSC_v3.4	1	249,392,727 - 249,404,075 (+)	RGD

Sequence:

show sequence

ATCCTCAGTCGCTGCAGATTCGGACCCTGCACTCTCTGCCTTCACAACAGGACCCAAACTTCCG
ACGAGCAAGATGACGGCCCTCTTGCCACGAGAGATTTCCAGCAAGTGTGGCACTACCACCATTG
TAGACTCTCACTCCTGGAGACATCAGGATGGAGAGGAGACGATACCCTTCCAGTCAGAAGACAT
CCGTCCTGAAATGAGAGAAGATATCCATGATCCCAGCTACCAGGATGAGGAGGGGCCCCCACCC
AAGCTGGAGTACGTCTGGAGGAACATCATCTTCATGGCCCTGCTGCACGTGGGAGCCCTGTACG
GGATCACACTAGTCCCCTCCTGCAAGGTCTACACCTGGCTCTTGGGAATATTCTATAACATAGT
TGCCGGTTTGGGCATCACAGCTGGGGCTCATCGCCTGTGGAGCCATCGAACCTATAAAGCAAGG
CTGCCCCTGAGGCTCTTCCTCATCATGGCGAACACCATGGCTTTCCAGAACGATGTGTACGAAT
GGGCCCGGGATCACCGCGCCCACCACAAATTCTCAGAGACACACGCCGACCCTCACAACTCCCG
CCGTGGCTTTTTCTTCTCTCACGTGGGTTGGCTGCTTGTGCGCAAACACCCGGCTGTCAAAGAG
AAGGGCGGAAAGCTGGACATGTCTGACCTAAAAGCTGAGAAGCTGGTGATGTTCCAGAGGAGGT
ACTACAAGCTGGCTGTCACCCTCATCTTCATCACCCTGCCCACAATGGTACCCTGGTACTTCTG
GGGTGAAACTCTCCGACACAGCCTGTGCGTCTCTACTTTCCTGCGGTATGCCGTGCTCCTAAAT
TTCACCTGGCTGGTGAACAGTGCCGCCCACCTCTACGGACACCAGCCCTACGACAGGAGCATTG
GTGCCCGAGAGAATCCCCTGGTGTCAGTGGCATCTTTAGGCGAGGGCTTCCACAACTACCATCA
CGCCTTCCCCTATGACTACTCTGTCAGTGAGTACCGCTGGCACATCAACTTCACCACGTTCTTC
ATTGACTGCATGGCTGCCCTGGGCCTGGCTTATGACCGGAAGAGAGTGTCCAAGGCCGCTGTCT
TAGCCAGGGTTAAAAGAACTGGAGATGGGAGCCACAAGAGTAGCTGAGTTTGGGGTCATCTGGT
CTCTGTACCATAACCAGCTGGGCCAACATTTAATGTTCTGTTAACTACTGAATAATGCCACCAA
AGCCCACTCCATTCCCCACCCCCTCTCTGTCATCTATTCAGCTCTATA

hide sequence

Protein Sequences


Protein RefSeqs	XP_574671	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94282	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017834.6

RefSeq Acc Id:

XP_574671 ⟸ XM_574671

- UniProtKB:

A6JHF8 (UniProtKB/TrEMBL), D4ABJ9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTALLPREISSKCGTTTIVDSHSWRHQDGEETIPFQSEDIRPEMREDIHDPSYQDEEGPPPKLE
YVWRNIIFMALLHVGALYGITLVPSCKVYTWLLGIFYNIVAGLGITAGAHRLWSHRTYKARLPL
RLFLIMANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGG
KLDMSDLKAEKLVMFQRRYYKLAVTLIFITLPTMVPWYFWGETLRHSLCVSTFLRYAVLLNFTW
LVNSAAHLYGHQPYDRSIGARENPLVSVASLGEGFHNYHHAFPYDYSVSEYRWHINFTTFFIDC
MAALGLAYDRKRVSKAAVLARVKRTGDGSHKSS

hide sequence

Ensembl Acc Id:

ENSRNOP00000046035 ⟸ ENSRNOT00000047602

Ensembl Acc Id:

ENSRNOP00000017834 ⟸ ENSRNOT00000017834

Protein Domains

Fatty acid desaturase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ABJ9-F1-model_v2	AlphaFold	D4ABJ9	1-353	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563648	AgrOrtholog
BioCyc Gene	G2FUF-55590	BioCyc
Ensembl Genes	ENSRNOG00000032554	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017834.7	UniProtKB/TrEMBL
InterPro	Fatty_acid_desaturase-1	UniProtKB/TrEMBL
	Fatty_acid_desaturase-1_C	UniProtKB/TrEMBL
	Fatty_acid_desaturase-1_core	UniProtKB/TrEMBL
KEGG Report	rno:499358	UniProtKB/TrEMBL
NCBI Gene	499358	ENTREZGENE
PANTHER	PTHR11351	UniProtKB/TrEMBL
	STEAROYL-COA DESATURASE 4	UniProtKB/TrEMBL
Pfam	FA_desaturase	UniProtKB/TrEMBL
PhenoGen	Scd4	PhenoGen
PRINTS	FACDDSATRASE	UniProtKB/TrEMBL
PROSITE	FATTY_ACID_DESATUR_1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000032554	RatGTEx
UniProt	A6JHF8	ENTREZGENE, UniProtKB/TrEMBL
	D4ABJ9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Scd4	stearoyl-coenzyme A desaturase 4	RGD1563648_predicted	similar to stearoyl-CoA desaturase-4 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1563648_predicted	similar to stearoyl-CoA desaturase-4 (predicted)	LOC499358	similar to stearoyl-CoA desaturase-4	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499358	similar to stearoyl-CoA desaturase-4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)