Advanced Search (OLGA)

Gene: Lancl3 (LanC like family member 3) Rattus norvegicus

Analyze

Symbol:

Lancl3

Name:

LanC like family member 3

RGD ID:

1563642

Description:

Predicted to be involved in carbohydrate metabolic process and peptide modification. Predicted to be active in plasma membrane. Orthologous to human LANCL3 (LanC like family member 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; copper atom.

Type:

protein-coding

RefSeq Status:

INFERRED

Previously known as:

LanC lantibiotic synthetase component C-like 3; LanC lantibiotic synthetase component C-like 3 (bacterial); LanC like 3; lanC-like protein 3; lanC-like protein 3-like; LOC100909554; LOC302540; RGD1563642; similar to LanC lantibiotic synthetase component C-like 3; similar to RIKEN cDNA 6030463G20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LANCL3 (LanC like family member 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Lancl3 (LanC lantibiotic synthetase component C-like 3 (bacterial))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lancl3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LANCL3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LANCL3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lancl3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LANCL3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LANCL3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lancl3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Lancl3 (LanC like family member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	LANCL3 (LanC like family member 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Lancl3 (LanC lantibiotic synthetase component C-like 3 (bacterial))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG2061	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	lancl3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	lancl3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	16,150,991 - 16,282,425 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	16,150,991 - 16,282,425 (-)	Ensembl				GRCr8
mRatBN7.2	X	13,478,499 - 13,609,934 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	13,480,311 - 13,609,678 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	13,668,026 - 13,802,683 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	17,164,957 - 17,299,612 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	13,421,537 - 13,556,192 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	14,358,224 - 14,490,340 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	14,358,224 - 14,490,340 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	15,139,374 - 15,271,030 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	25,632,939 - 25,763,093 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	13,918,129 - 13,943,497 (+)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

choline (ISO)

copper atom (EXP)

copper(0) (EXP)

diazinon (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

folic acid (ISO)

gallic acid (ISO)

glyphosate (ISO)

iron dichloride (ISO)

L-methionine (ISO)

paracetamol (EXP)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate metabolic process (IEA)

peptide modification (IEA)

Molecular Function

metal ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Lancl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	16,150,991 - 16,282,425 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	X	16,150,991 - 16,282,425 (-)	Ensembl				GRCr8
mRatBN7.2	X	13,478,499 - 13,609,934 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	13,480,311 - 13,609,678 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	13,668,026 - 13,802,683 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	17,164,957 - 17,299,612 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	13,421,537 - 13,556,192 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	14,358,224 - 14,490,340 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	14,358,224 - 14,490,340 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	X	15,139,374 - 15,271,030 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	X	25,632,939 - 25,763,093 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	X	13,918,129 - 13,943,497 (+)	NCBI		Celera
Cytogenetic Map	X	q12	NCBI

LANCL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	37,571,661 - 37,684,463 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	37,571,569 - 37,684,463 (+)	Ensembl			hg38	GRCh38
GRCh37	X	37,430,914 - 37,543,716 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	37,315,741 - 37,421,668 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	X	37,187,013 - 37,292,941	NCBI
Celera	X	41,568,483 - 41,674,412 (+)	NCBI		Celera
Cytogenetic Map	X	p21.1	NCBI
HuRef	X	35,177,392 - 35,283,210 (+)	NCBI		HuRef
CHM1_1	X	37,461,942 - 37,567,881 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	X	36,975,217 - 37,088,020 (+)	NCBI		T2T-CHM13v2.0

Lancl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	9,066,212 - 9,134,324 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	9,066,141 - 9,134,324 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	X	9,199,973 - 9,268,085 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	9,199,902 - 9,268,085 (+)	Ensembl			mm10	GRCm38
MGSCv37	X	8,777,099 - 8,845,211 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	X	8,356,932 - 8,425,044 (+)	NCBI		MGSCv36	mm8
Celera	X	6,939,793 - 7,007,686 (+)	NCBI		Celera
Cytogenetic Map	X	A1.1	NCBI
cM Map	X	4.18	NCBI

Lancl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955587	556,105 - 658,735 (+)	Ensembl
ChiLan1.0	NW_004955587	556,105 - 658,735 (+)	NCBI	ChiLan1.0	ChiLan1.0

LANCL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	39,219,967 - 39,333,348 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	39,223,341 - 39,336,722 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	30,021,481 - 30,134,830 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	37,731,552 - 37,838,564 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	37,731,552 - 37,838,564 (+)	Ensembl			panPan2	panpan1.1

LANCL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	32,349,007 - 32,452,130 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	32,349,269 - 32,443,254 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	19,697,168 - 19,799,843 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	32,388,686 - 32,489,931 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	32,388,634 - 32,482,657 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	32,475,050 - 32,577,678 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	32,439,725 - 32,542,739 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	32,487,876 - 32,590,728 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Lancl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	24,578,494 - 24,681,314 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936502	4,419,474 - 4,520,795 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936502	4,419,279 - 4,522,025 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LANCL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	33,427,444 - 33,541,304 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	X	33,426,731 - 33,543,506 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	37,128,910 - 37,198,298 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LANCL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666056	38,041,100 - 38,147,980 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lancl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624762	17,925,158 - 18,033,734 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624762	17,916,148 - 18,033,799 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Lancl3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	X	11,900,009 - 11,925,217 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Lancl3
754 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	92
Count of miRNA genes:	74
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000005042
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70165	Bp64	Blood pressure QTL 64	5.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	X	4001493	44939387	Rat
731181	Uae27	Urinary albumin excretion QTL 27	2.7	0.0059	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	X	1970440	46970440	Rat
631666	Iddm5	Insulin dependent diabetes mellitus QTL 5			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	X	8111486	53111486	Rat
634325	Bw13	Body weight QTL 13	0		body mass (VT:0001259)	body weight (CMO:0000012)	X	4001493	24470521	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	11	58	132	69	65	39	70	39	6	283	151	3	114	70	90	26	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005042 ⟹ ENSRNOP00000005042

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	X	16,150,991 - 16,282,425 (-)	Ensembl
mRatBN7.2 Ensembl	X	13,480,311 - 13,609,678 (-)	Ensembl
Rnor_6.0 Ensembl	X	14,358,224 - 14,490,340 (+)	Ensembl

RefSeq Acc Id:

NM_001191728 ⟹ NP_001178657

RefSeq Status:

INFERRED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	16,150,991 - 16,282,425 (-)	NCBI
mRatBN7.2	X	13,478,499 - 13,609,934 (-)	NCBI
Rnor_6.0	X	14,358,224 - 14,490,340 (+)	NCBI
Rnor_5.0	X	15,139,374 - 15,271,030 (+)	NCBI
Celera	X	13,918,129 - 13,943,497 (+)	NCBI

Sequence:

show sequence

ATGGACACCAAGCGCTGCTTCGCCAACCGCTTCGATGACTACCAGGGCAGCCTGCTGGCGGGCC
AGTGCGAGGAGGCAGTGGCGCCCTTGGTCACCTCCACCATCGAACGCATCCTTCAGGAGCTGCC
CCCGCTGGGTGGCGGCGCTGAGGCTCGGGGAGCGACGGCCGCGGGCAGCAGCTGCCAGGGGGGT
CTGTACAGCGGTGTGGCTGGGGTGGCCTACATGCTCTACCACGTCTCGCAGAGCCCGCTTTTCG
CCGCCGCCCGGGAGCGCTACCTGCGCTCCGCCAAGCGCCTCATCGACGCGTGCTCACGCGCCGA
GGAGTGGGGCGAGACGGACGCGGACACCCGCGCCGCCTTTCTGCTCGGGGGCGCGGGCGTGTAC
GCGGTGGCCACACTTGTCTACCACGCCCTGGGCCGCTCCGACTATGTGCAGCCCCTCAGCAAGT
TCCGGGCTCTGTGCGCCGTCTGCGCTCCTGTCTCCTTCCTGGAGTGCGGCTCCGACGAGCTGTT
CGTGGGCCGCGCTGGCTACCTGTGCGCTGCGCTCGTGCTCAAGCAGAAGCTTGCCCAGGAGGTA
TTGACTCCAGCACAAATTAAAGCAATATGCCAGGCAATTCTGGACTCCGGAAAGCAGTATGCTC
TGAAGAAGAGAAAACCATTCCCCCTGATGTATTCTTACTATGGAACGGAATACCTGGGGGCAGC
TCATGGCCTGTCGTCCATTCTCCAAATGCTCCTTTCTTACCACGAGCATCTCAAACCTTCAGAC
CGGGAGCTGGTGTGGCAGAGTGTGGACTTCCTCATGGAACAGGAACAGAATTGCAACTGGCCAC
CAGAGCTCGGAGAGACCATCGAGAGAGAGAATGAACTCGTCCACTGGTGCCATGGCGCTCCAGG
AATTGCTTATCTGTTTGCCAAAGCTTATCTCATTTCCAAGAAGCCGCAGTATCTGGACACATGT
ATCCGGTGTGGGGAGCTAACATGGCAGAAAGGCCTGTTGAAGAAGGGGCCGGGGATCTGCCACG
GTGTAGCTGGCAGTGCATATGTCTTCCTTCTTCTCTACCGTCTTACAGGAAACTCGAAGTACAT
CTACCGTGCCCAAAGGTTTGCTCAGTTCTTATTCACTGAAGAATTCAAAGCCGGTTCACGGGTC
CTTGAAAGCATATACAGCTTGTATGAAGGCTTCTCTGGGACTGTTTGCTTTCTCATTGATCTTC
TACAGCCCAATCAGGCTGAATTTCCTCTCTTCAGCGTCTTTGTTTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178657	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005042
	ENSRNOP00000005042.5

RefSeq Acc Id:

NP_001178657 ⟸ NM_001191728

- UniProtKB:

D3ZG98 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDTKRCFANRFDDYQGSLLAGQCEEAVAPLVTSTIERILQELPPLGGGAEARGATAAGSSCQGG
LYSGVAGVAYMLYHVSQSPLFAAARERYLRSAKRLIDACSRAEEWGETDADTRAAFLLGGAGVY
AVATLVYHALGRSDYVQPLSKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEV
LTPAQIKAICQAILDSGKQYALKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHLKPSD
RELVWQSVDFLMEQEQNCNWPPELGETIERENELVHWCHGAPGIAYLFAKAYLISKKPQYLDTC
IRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKAGSRV
LESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV

hide sequence

Ensembl Acc Id:

ENSRNOP00000005042 ⟸ ENSRNOT00000005042

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZG98-F1-model_v2	AlphaFold	D3ZG98	1-420	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563642	AgrOrtholog
BioCyc Gene	G2FUF-2975	BioCyc
Ensembl Genes	ENSRNOG00000003756	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005042	ENTREZGENE
	ENSRNOT00000005042.7	UniProtKB/TrEMBL
Gene3D-CATH	1.50.10.10	UniProtKB/TrEMBL
InterPro	6hp_glycosidase-like_sf	UniProtKB/TrEMBL
	LANC-like	UniProtKB/TrEMBL
	LanC-like_prot_euk	UniProtKB/TrEMBL
KEGG Report	rno:302540	UniProtKB/TrEMBL
NCBI Gene	302540	ENTREZGENE
PANTHER	LANC-LIKE PROTEIN	UniProtKB/TrEMBL
	LANC-LIKE PROTEIN 3	UniProtKB/TrEMBL
Pfam	LANC_like	UniProtKB/TrEMBL
PhenoGen	Lancl3	PhenoGen
PRINTS	LANCEUKARYTE	UniProtKB/TrEMBL
	LANCSUPER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003756	RatGTEx
SMART	LANC_like	UniProtKB/TrEMBL
Superfamily-SCOP	LanC-like	UniProtKB/TrEMBL
UniProt	D3ZG98	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-10-03	Lancl3	LanC like family member 3	Lancl3	LanC like 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2021-03-09	Lancl3	LanC like 3	LOC100909554	lanC-like protein 3-like	Data merged from RGD:6502978	737654	PROVISIONAL
2016-01-13	Lancl3	LanC like 3	Lancl3	LanC lantibiotic synthetase component C-like 3 (bacterial)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Lancl3	LanC lantibiotic synthetase component C-like 3 (bacterial)	LOC682660	similar to LanC lantibiotic synthetase component C-like 3	Data merged from RGD:1596632	1643240	APPROVED
2013-05-24	Lancl3	LanC lantibiotic synthetase component C-like 3 (bacterial)	LOC679199	similar to LanC lantibiotic synthetase component C-like 3	Data merged from RGD:1591800	1643240	APPROVED
2012-07-05	LOC100909554	lanC-like protein 3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	Lancl3	LanC lantibiotic synthetase component C-like 3 (bacterial)	Lancl3_predicted	LanC lantibiotic synthetase component C-like 3 (bacterial) (predicted)	'predicted' is removed	2292626	APPROVED
2006-11-20	LOC682660	similar to LanC lantibiotic synthetase component C-like 3			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC679199	similar to LanC lantibiotic synthetase component C-like 3			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-30	Lancl3_predicted	LanC lantibiotic synthetase component C-like 3 (bacterial) (predicted)	RGD1563642_predicted	similar to RIKEN cDNA 6030463G20 (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1563642_predicted	similar to RIKEN cDNA 6030463G20 (predicted)	LOC302540	similar to RIKEN cDNA 6030463G20	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC302540	similar to RIKEN cDNA 6030463G20			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message