Advanced Search (OLGA)

Gene: C1h9orf40 (similar to human chromosome 9 open reading frame 40) Rattus norvegicus

Analyze

Symbol:

C1h9orf40

Name:

similar to human chromosome 9 open reading frame 40

RGD ID:

1563237

Description:

Orthologous to human C9orf40 (chromosome 9 open reading frame 40); INTERACTS WITH bisphenol A; all-trans-retinoic acid (ortholog); aristolochic acid A (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC499331; LOC499331; similar to hypothetical protein D030056L22; uncharacterized protein C9orf40 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	225,555,300 - 225,559,509 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	225,555,280 - 225,559,693 (+)	Ensembl				GRCr8
mRatBN7.2	1	216,128,687 - 216,132,896 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	216,128,651 - 216,133,045 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	224,462,248 - 224,466,459 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	231,398,791 - 231,403,001 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	224,216,782 - 224,220,993 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	234,665,904 - 234,670,113 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	234,665,905 - 234,670,113 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	241,765,682 - 241,769,891 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	222,309,341 - 222,313,550 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	213,427,725 - 213,431,934 (+)	NCBI		Celera
Cytogenetic Map	1	q51	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP)

calcitriol (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

Enterolactone (ISO)

FR900359 (ISO)

glycidyl methacrylate (ISO)

leflunomide (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

phenylmercury acetate (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

testosterone (ISO)

trichostatin A (ISO)

valproic acid (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
2.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334

Genomics

Comparative Map Data

C1h9orf40
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	225,555,300 - 225,559,509 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	225,555,280 - 225,559,693 (+)	Ensembl				GRCr8
mRatBN7.2	1	216,128,687 - 216,132,896 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	216,128,651 - 216,133,045 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	224,462,248 - 224,466,459 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	231,398,791 - 231,403,001 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	224,216,782 - 224,220,993 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	234,665,904 - 234,670,113 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	234,665,905 - 234,670,113 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	241,765,682 - 241,769,891 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	222,309,341 - 222,313,550 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	213,427,725 - 213,431,934 (+)	NCBI		Celera
Cytogenetic Map	1	q51	NCBI

C9orf40
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	74,946,583 - 74,952,912 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	74,946,583 - 74,952,912 (-)	Ensembl			hg38	GRCh38
GRCh37	9	77,561,499 - 77,567,828 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	76,751,319 - 76,757,622 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	74,791,431 - 74,797,356	NCBI
Celera	9	48,135,332 - 48,141,635 (-)	NCBI		Celera
Cytogenetic Map	9	q21.13	NCBI
HuRef	9	47,383,471 - 47,389,771 (-)	NCBI		HuRef
CHM1_1	9	77,707,780 - 77,714,083 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	87,099,484 - 87,105,814 (-)	NCBI		T2T-CHM13v2.0

D030056L22Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	18,690,599 - 18,695,793 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	18,690,557 - 18,695,792 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	18,713,235 - 18,718,429 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	18,713,193 - 18,718,428 (+)	Ensembl			mm10	GRCm38
MGSCv37	19	18,787,726 - 18,792,918 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	18,780,255 - 18,785,447 (+)	NCBI		MGSCv36	mm8
Celera	19	19,402,013 - 19,407,185 (+)	NCBI		Celera
Cytogenetic Map	19	B	NCBI
cM Map	19	13.2	NCBI

C11H9orf40
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	74,111,413 - 74,120,858 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	74,117,352 - 74,123,788 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	49,885,756 - 49,892,188 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	73,799,237 - 73,805,612 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

C1H9orf40
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	83,244,326 - 83,250,356 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	83,243,848 - 83,249,675 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	83,708,547 - 83,714,590 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	83,694,505 - 83,700,406 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	83,694,520 - 83,699,313 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	83,446,040 - 83,452,070 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	83,164,516 - 83,170,544 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	83,924,995 - 83,931,035 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

CUNH9orf40
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	33,800,065 - 33,800,541 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936837	163,152 - 165,956 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C1H9orf40
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	228,033,996 - 228,045,013 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	228,038,184 - 228,045,225 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	254,937,432 - 254,944,712 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C12H9orf40
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	85,996,509 - 86,002,835 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	85,996,126 - 86,002,356 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	74,439,986 - 74,446,724 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH9orf40
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624811	2,570,896 - 2,575,426 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624811	2,529,304 - 2,575,746 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

C2H9orf40
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	18,718,654 - 18,723,228 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in C1h9orf40
7 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	145
Count of miRNA genes:	105
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000017133
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8693637	Alc29	Alcohol consumption QTL 29	2.7	0.258	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	217412367	243666627	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	207243873	252243873	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	181059071	226059071	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	181059071	226059071	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	223964326	248681945	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	182039247	227039247	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	183564652	228564652	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	193964073	238964073	Rat
8693661	Alc34	Alcohol consumption QTL 34	2.2	0.611	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	217412367	238041033	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	181059071	226059071	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	181059071	226059071	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	194575422	239575422	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	193400541	238400541	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	182535316	227535316	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	146080545	243492863	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	181059071	226059071	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	153679879	232414077	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	160574007	235238518	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	181059071	226059071	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	207243873	252243873	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	181059071	226059071	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	209203273	254203273	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	202543537	247543537	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	205674651	250674651	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	207243873	252243873	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	203300512	229359342	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	180739993	225739993	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	172718770	228180370	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	188241285	250779312	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	208798288	253798288	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	221820316	234540296	Rat
1300168	Bp170	Blood pressure QTL 170	2.76		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	192995199	237995199	Rat
61403	Niddm4	Non-insulin dependent diabetes mellitus QTL 4			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	201464383	246464383	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	186298393	231298393	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	203675682	248675682	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	205674651	250674651	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	185979875	230979875	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	197807365	233480676	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	193400541	238400541	Rat
634340	Hcar5	Hepatocarcinoma resistance QTL 5	8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	223964326	236074012	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	173363824	227535316	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	207099883	252099883	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
8693618	Alc25	Alcohol consumption QTL 25	3	0.28	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	217412367	238041033	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	191260175	236260175	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2325727	Pia41	Pristane induced arthritis QTL 41			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	188241285	233241285	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat

Markers in Region

RH131291

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	216,132,603 - 216,132,799 (-)	MAPPER	mRatBN7.2
mRatBN7.2	9	3,144,392 - 3,144,593 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	732,958 - 733,158	NCBI	Rnor6.0
Rnor_6.0	1	234,666,001 - 234,666,196	NCBI	Rnor6.0
Rnor_5.0	1	241,765,779 - 241,765,974	UniSTS	Rnor5.0
Rnor_5.0	9	699,721 - 699,921	UniSTS	Rnor5.0
RGSC_v3.4	1	222,313,258 - 222,313,453	UniSTS	RGSC3.4
Celera	9	49,638 - 49,838	UniSTS
Celera	1	213,431,642 - 213,431,837	UniSTS
Cytogenetic Map	1	q43	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC082069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017133 ⟹ ENSRNOP00000017155

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	225,555,280 - 225,559,693 (+)	Ensembl
mRatBN7.2 Ensembl	1	216,128,651 - 216,133,045 (+)	Ensembl
Rnor_6.0 Ensembl	1	234,665,905 - 234,670,113 (-)	Ensembl

RefSeq Acc Id:

NM_001024293 ⟹ NP_001019464

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	225,555,300 - 225,559,509 (+)	NCBI
mRatBN7.2	1	216,128,687 - 216,132,896 (+)	NCBI
Rnor_6.0	1	234,665,904 - 234,670,113 (-)	NCBI
Rnor_5.0	1	241,765,682 - 241,769,891 (-)	NCBI
RGSC_v3.4	1	222,309,341 - 222,313,550 (+)	RGD
Celera	1	213,427,725 - 213,431,934 (+)	RGD

Sequence:

show sequence

CTGTGTTGCGGCTCCCTCAACGTCCGGCCCACCCTCGGGACGTCCCGAGCTCAGTGCCACCCTC
CACCTGCCGCCCACGCGACCCGCATCCCTGGCCCATGGCCAAGCGGCGTGCGGCTGAGCCGCTC
ACGTTCCGCGTGCCTTGGAAGCGGCTCCTGCTCAGCGACTTCCCCGAGGAGCCGCCGCTCTGGG
TCCCGCCGTCTGGGGCGGCTCGGCCCCTCAAGCGCCAGGGGGACGCGGGGACCATGGCCGAACC
TGCGTCTGCACCCCGTAAACGACGAGGCGGTGGGGACGACGAACCGGAGCTGCAGGGCCGTGGC
CTGGAGCCCGGAGAGCCACCTCCTGGGGAACAGGGGGAGCCCCAGGTCAGCCGGGCCGCGGGCG
GCGGCGACAGGGTAGAGAGCGCGGGCAGCCCGCAGGGAGCCGACGAGGTGCACAGCCAGCACAA
TGAAGACTTTTGGCAGTATAATACATTCCAGTATTGGAGGAACCCTCTACCACCTATTGATCTG
GCAGCTCTTGAAGATGTGAGTGCAAACAGCCTGACAGAAACCCTTGAGGACAAGAATGAAGGAG
TTGAGATTGACATGGAGTCCTGACAGAAGGATCCAAAGGAATGGGATTCATTGAATTGGAGGAG
ACCTATGGAAAAGTTCTTTTCCATACTTGACATGATACTCTTTTCAAACCTGAAATATGAGGAA
GAGTTCTGGGATAAATAACTAATTACTACTGAATCTCCTCATGGAGAGTTGGAAAGGATATATA
CAGCTGCAGACAAAATACTTTGTGTATACATTTTTAATGAAGAAAGTTTTGTTCGTGCTCTTGA
CTTTGAAGATGCTTATCTTAGAAAAGGAGGTTTTGGACAGTCTAAGAGGAAGCACTCGGGTCTT
CCACACTTGTTCTGTCAAATGTTCCTTTGTACCAGAAAGCTTATTTGTGGTACACGGAATGAAT
TCATTTATACAGCGGATGCTAATAAGTACTTTCTAGTACATCTTATTGGCTCCCCTTGGTTGAA
CAAATAGGAGACATGCAAATAAGAACAAATAGGAGTATCTATGCAAAAGTAAAATGTGGGATTG
TTCCTGGAAATTAGCTTTGTTCTAAGAGTGTAAATTTAAACTAGTGAGAACTTCCATTTGGGTA
GCTTGTTTTAACTTTCACTATTTACTGTTTATTAAAACAGTATAGGCAATGAGTACAGCCAAAC
AATGGATAGAGAACAGTAGAAAGCAGATGCCTGCCCCTCCCCCCTTTTTCTGAGATGAAAGAAA
TGATCTGGTCAGTTTACTGATTTTTGTTGTGAGGACATTTTTTATATTGTTGATTACTTCAGAT
CTGTAGTTCTCAACACTTAGAGCACTTTAACCATCTCTGCTTGAGCCCTGGTCCTAGAGAGATC
TCATTCAACTATTTGCAGGTGACTTTACACATAGGTTGTTTTGTTTTATTTTATTTTTGCACCA
ATTCTGTATCCTGTATTGTGTAGGTGGGGCCAGAACCACTAGACCAGCAGCTTTTCCTATTTAA
AGGAGATCACTAGTGCAAGCTGCAGCAACGCCTCTTCATTAGTTTTGTCTATATCTTATGTTAC
TTGATTTGTCGTTACTAAGTTATTGTGTTACAATTTATTTTTTAATAAAGTACACTGTTTATGT
TTGAGCTATGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001019464	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH82069	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017155
	ENSRNOP00000017155.3
GenBank Protein	Q66H24	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001019464 ⟸ NM_001024293
- UniProtKB:	Q66H24 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAKRRAAEPLTFRVPWKRLLLSDFPEEPPLWVPPSGAARPLKRQGDAGTMAEPASAPRKRRGGG DDEPELQGRGLEPGEPPPGEQGEPQVSRAAGGGDRVESAGSPQGADEVHSQHNEDFWQYNTFQY WRNPLPPIDLAALEDVSANSLTETLEDKNEGVEIDMES hide sequence

Ensembl Acc Id:

ENSRNOP00000017155 ⟸ ENSRNOT00000017133

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q66H24-F1-model_v2	AlphaFold	Q66H24	1-166	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690805

Promoter ID:

EPDNEW_R1330

Type:

initiation region

Name:

LOC499331_1

Description:

similar to hypothetical protein D030056L22

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	234,670,125 - 234,670,185	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563237	AgrOrtholog
BioCyc Gene	G2FUF-56196	BioCyc
Ensembl Genes	ENSRNOG00000025644	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000017133	ENTREZGENE
	ENSRNOT00000017133.5	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7132875	IMAGE-MGC_LOAD
InterPro	C9orf40-like	UniProtKB/Swiss-Prot
	WRNPLPNID	UniProtKB/Swiss-Prot
KEGG Report	rno:499331	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95232	IMAGE-MGC_LOAD
NCBI Gene	499331	ENTREZGENE
PANTHER	CHROMOSOME 9 C9ORF40 HOMOLOG	UniProtKB/Swiss-Prot
	PTHR16003	UniProtKB/Swiss-Prot
Pfam	WRNPLPNID	UniProtKB/Swiss-Prot
PhenoGen	C1h9orf40	PhenoGen
RatGTEx	ENSRNOG00000025644	RatGTEx
UniProt	CI040_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-05-27	C1h9orf40	similar to human chromosome 9 open reading frame 40	LOC499331	similar to hypothetical protein D030056L22	Name and Symbol changed	629549	APPROVED
2006-02-09	LOC499331	similar to hypothetical protein D030056L22			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message