Advanced Search (OLGA)

Gene: Tigit (T cell immunoreceptor with Ig and ITIM domains) Rattus norvegicus

Analyze

Symbol:

Tigit

Name:

T cell immunoreceptor with Ig and ITIM domains

RGD ID:

1563191

Description:

Predicted to enable identical protein binding activity; signaling receptor activity; and signaling receptor binding activity. Predicted to be involved in negative regulation of T cell activation; negative regulation of interleukin-12 production; and positive regulation of interleukin-10 production. Predicted to act upstream of or within natural killer cell mediated cytotoxicity and negative regulation of natural killer cell mediated cytotoxicity. Predicted to be located in membrane. Predicted to be active in cell surface and plasma membrane. Orthologous to human TIGIT (T cell immunoreceptor with Ig and ITIM domains); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; glyphosate; vinclozolin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC363784; RGD1563191; similar to hypothetical protein; T-cell immunoreceptor with Ig and ITIM domains

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	70,534,907 - 70,552,452 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	70,534,848 - 70,552,467 (+)	Ensembl				GRCr8
mRatBN7.2	11	57,029,024 - 57,046,627 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	57,029,118 - 57,045,994 (+)	Ensembl				mRatBN7.2
Rnor_6.0	11	61,966,780 - 61,987,749 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	61,970,976 - 61,987,760 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	61,100,049 - 61,120,824 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	58,618,187 - 58,635,015 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	56,581,374 - 56,598,622 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

Dibutyl phosphate (ISO)

fulvestrant (ISO)

glyphosate (EXP)

GSK-J4 (ISO)

lipopolysaccharide (ISO)

methcathinone (ISO)

Moniliformin (ISO)

nickel atom (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of interleukin-12 production (IBA,IEA,ISO)

negative regulation of natural killer cell mediated cytotoxicity (IEA,ISO)

negative regulation of T cell activation (IBA,IEA,ISO)

positive regulation of interleukin-10 production (IBA,IEA,ISO)

Cellular Component

cell surface (IBA,IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

identical protein binding (IEA,ISO)

protein binding (ISO)

signaling receptor activity (IEA,ISO)

signaling receptor binding (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:19011627	PMID:21199897	PMID:21416464	PMID:27978489

Genomics

Comparative Map Data

Tigit
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	70,534,907 - 70,552,452 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	70,534,848 - 70,552,467 (+)	Ensembl				GRCr8
mRatBN7.2	11	57,029,024 - 57,046,627 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	57,029,118 - 57,045,994 (+)	Ensembl				mRatBN7.2
Rnor_6.0	11	61,966,780 - 61,987,749 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	61,970,976 - 61,987,760 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	61,100,049 - 61,120,824 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	58,618,187 - 58,635,015 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	56,581,374 - 56,598,622 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

TIGIT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	114,294,028 - 114,310,288 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	114,276,913 - 114,310,288 (+)	Ensembl			hg38	GRCh38
GRCh37	3	114,012,875 - 114,029,135 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	115,495,565 - 115,511,038 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	112,420,299 - 112,436,499 (+)	NCBI		Celera
Cytogenetic Map	3	q13.31	NCBI
HuRef	3	111,385,681 - 111,401,895 (+)	NCBI		HuRef
CHM1_1	3	113,975,847 - 113,992,048 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	117,011,991 - 117,031,081 (+)	NCBI		T2T-CHM13v2.0

Tigit
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	43,469,224 - 43,485,494 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	43,469,230 - 43,484,509 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	43,626,137 - 43,665,125 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	43,648,867 - 43,664,146 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	43,648,974 - 43,664,297 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	43,649,114 - 43,664,297 (-)	NCBI		MGSCv36	mm8
Celera	16	44,003,410 - 44,018,650 (-)	NCBI		Celera
Cytogenetic Map	16	B4	NCBI
cM Map	16	28.44	NCBI

Tigit
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	14,360,272 - 14,382,524 (+)	Ensembl
ChiLan1.0	NW_004955427	14,358,326 - 14,381,074 (+)	NCBI	ChiLan1.0	ChiLan1.0

TIGIT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	112,278,559 - 112,294,765 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	112,283,413 - 112,299,543 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	111,424,940 - 111,441,126 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	118,344,588 - 118,360,939 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	118,344,459 - 118,360,939 (+)	Ensembl			panPan2	panpan1.1

TIGIT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	18,484,106 - 18,501,517 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	18,485,955 - 18,499,440 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	18,592,840 - 18,608,590 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	18,731,173 - 18,746,925 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	18,731,359 - 18,746,924 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	18,538,986 - 18,554,739 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	18,585,866 - 18,601,612 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	19,131,089 - 19,146,839 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tigit
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	135,775,157 - 135,790,568 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936536	1,731,352 - 1,746,763 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936536	1,731,352 - 1,746,843 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TIGIT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	145,673,658 - 145,692,988 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	145,673,646 - 145,799,024 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	155,180,469 - 155,200,775 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TIGIT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	66,555,560 - 66,572,206 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	99,892,201 - 99,907,826 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tigit
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	34,203,346 - 34,220,389 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624731	34,203,313 - 34,220,389 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tigit
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	28,553,928 - 28,570,148 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tigit
188 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	31
Count of miRNA genes:	28
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000059622
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	67962184	99753367	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	68599321	96497754	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	69855943	99753367	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	8	32	55	48	50	22	91	22	4	233	142	6	42	47	50	28	4	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001430791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006248323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008776689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078921 ⟹ ENSRNOP00000074881

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	70,534,848 - 70,552,467 (+)	Ensembl
mRatBN7.2 Ensembl	11	57,029,118 - 57,045,994 (+)	Ensembl
Rnor_6.0 Ensembl	11	61,970,976 - 61,987,760 (+)	Ensembl

RefSeq Acc Id:

XM_008768765 ⟹ XP_008766987

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	70,534,907 - 70,552,452 (+)	NCBI
mRatBN7.2	11	57,029,024 - 57,046,627 (+)	NCBI
Rnor_6.0	11	61,970,617 - 61,987,749 (+)	NCBI

Sequence:

show sequence

GAAGGGCCAGGGAGGGGAGGGGACTGACTCATCAGAAATAGTTCTTCCGAATCCTGTGCGTCAC
ATACATGCTCTCGCTTTAGATAAAAGTTGGTATTTCAGAAAGTGCATCAAGATAACTTAAAAAC
AACAGATCGACTACCCAAGTAGTCAATATACAAATTACCCAAGACCTGTATATCTCTAACCACA
TGTTTTATTTGTTTTTACAGTATTTCCTTCGTGGCCTTTCTTGTGGCTCACCCTGTGTGGCTTG
TGTACTTGTTGAGAACATCAGGCGTTTGACACTGCTCTTTCCTAAGTCAGTTTTTCCGAGACCC
TCTTGTCACAGGCTCGGTTTCACCTGACACCTGCAGAGGGCCAGTTTCAGTTGGAGGAAAGGCC
ACTTCCACTTTCCCGTAGGCCTCTGATTAGAAGCATGCATGGCTGGATGCTCCTGGTCTGGGTC
CAGGGGCTGACAGAAACTGCCTTCCTTGCTGCAGGAGCCACAGCAGGCACAATGGAGACAAAGG
GGAACATCTCTGCAGAAGAAGGTGGCTCTGTCGTCTTACAATGTCACTTCTCCTCCGACACAGC
TGAAGTGACCCAAGTCAACTGGGAGCAGCGGGACCAGCTTCTGGCCGTTTACAGTGTTGATCTG
GGGTGGTATGTCCCCTCGGTCTTCAGTGATCGAGTGGTCCCAGGCCCCAGCCTAGGCCTCACCT
TCCAGTCACTGACCACGAATGACACAGGAGAATACTTCTGCACCTATCATACCTATCCCGATGG
GATTTACAAGGGGAGAATATTCCTGAAGGTCCAGGAAAGCTCAGCTCATTTCCAGATTGCCTTG
CCTGGAGGGACCATGGCAGCTGTGTTGGGACTCATTTGCTTAATGGCCACAGGGGTGACTGTAC
TGGCTAGAAAGAAGTCTATTAGAATGCATTCTGTAGAGAGCGGCCTTGGGAGAACGGAAGCTGA
GCCACAGGAATGGAACCTCAGGATTCTCTTATCCCCTAGCGGCCCTGTCCAGACACAAGCTGCC
CCTGCTGACCTCTGTGGAGAGCAGACAGAAGATGACTATACTGATCCACAGGACTACTTTAATG
TCTTGAGCTACAGAAGCCTAGAGAGCTTCATTGCTTTGTCAAAAACTGGCCAATGACAGCTCCC
TCTCCCTCCCCCTCCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001417720	(Get FASTA)	NCBI Sequence Viewer
	XP_008766987	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074881
	ENSRNOP00000074881.3

RefSeq Acc Id:

XP_008766987 ⟸ XM_008768765

- Sequence:

show sequence

MHGWMLLVWVQGLTETAFLAAGATAGTMETKGNISAEEGGSVVLQCHFSSDTAEVTQVNWEQRD
QLLAVYSVDLGWYVPSVFSDRVVPGPSLGLTFQSLTTNDTGEYFCTYHTYPDGIYKGRIFLKVQ
ESSAHFQIALPGGTMAAVLGLICLMATGVTVLARKKSIRMHSVESGLGRTEAEPQEWNLRILLS
PSGPVQTQAAPADLCGEQTEDDYTDPQDYFNVLSYRSLESFIALSKTGQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000074881 ⟸ ENSRNOT00000078921

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTQ2-F1-model_v2	AlphaFold	D3ZTQ2	1-242	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563191	AgrOrtholog
BioCyc Gene	G2FUF-21328	BioCyc
Ensembl Genes	ENSRNOG00000056574	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000078921	ENTREZGENE
	ENSRNOT00000078921.4	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
InterPro	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/TrEMBL
	TIGIT	UniProtKB/TrEMBL
NCBI Gene	363784	ENTREZGENE
PANTHER	PTHR47734	UniProtKB/TrEMBL
	T-CELL IMMUNORECEPTOR WITH IG AND ITIM DOMAINS	UniProtKB/TrEMBL
Pfam	V-set	UniProtKB/TrEMBL
PhenoGen	Tigit	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000056574	RatGTEx
SMART	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/TrEMBL
UniProt	D3ZTQ2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-05-05	Tigit	T cell immunoreceptor with Ig and ITIM domains	RGD1563191	similar to hypothetical protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1563191	similar to hypothetical protein	RGD1563191_predicted	similar to hypothetical protein (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1563191_predicted	similar to hypothetical protein (predicted)	LOC363784	similar to hypothetical protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC363784	similar to hypothetical protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message