Advanced Search (OLGA)

Gene: Dkk4 (dickkopf WNT signaling pathway inhibitor 4) Rattus norvegicus

Analyze

Symbol:

Dkk4

Name:

dickkopf WNT signaling pathway inhibitor 4

RGD ID:

1563172

Description:

Predicted to enable co-receptor binding activity and receptor antagonist activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway. Predicted to act upstream of or within Wnt signaling pathway and negative regulation of hair follicle placode formation. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human DKK4 (dickkopf WNT signaling pathway inhibitor 4); PARTICIPATES IN Wnt signaling, canonical pathway; Wnt signaling pathway; INTERACTS WITH acrylamide; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dickkopf homolog 4; dickkopf homolog 4 (Xenopus laevis); dickkopf-related protein 4; LOC502097; RGD1563172; similar to Dickkopf homolog 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	76,105,679 - 76,109,044 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	76,105,679 - 76,109,044 (-)	Ensembl				GRCr8
mRatBN7.2	16	69,403,215 - 69,406,580 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	69,402,989 - 69,406,580 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	74,676,916 - 74,680,281 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	78,108,488 - 78,111,869 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	73,357,687 - 73,361,068 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	74,260,551 - 74,264,142 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	74,260,551 - 74,264,142 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	73,893,385 - 73,896,976 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	73,888,290 - 73,891,881 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	67,295,927 - 67,299,518 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

amphotericin B (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

carbon nanotube (ISO)

ceric oxide (ISO)

CGP 52608 (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

deguelin (ISO)

dichloroacetic acid (ISO)

ethylparaben (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

N-nitrosodiethylamine (ISO)

parathion (ISO)

PCB138 (ISO)

potassium dichromate (ISO)

quercetin (ISO)

tamoxifen (ISO)

Theaflavin 3,3'-digallate (ISO)

thiram (ISO)

trichloroethene (EXP)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of canonical Wnt signaling pathway (IBA)

negative regulation of hair follicle placode formation (ISO)

negative regulation of Wnt signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Cellular Component

extracellular region (IEA)

extracellular space (IBA)

Molecular Function

co-receptor binding (IBA)

protein binding (ISO)

receptor antagonist activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

Wnt signaling pathway (IEA)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Function and biological roles of the Dickkopf family of Wnt modulators.	Niehrs C Oncogene. 2006 Dec 4;25(57):7469-81.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18508042

Genomics

Comparative Map Data

Dkk4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	76,105,679 - 76,109,044 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	76,105,679 - 76,109,044 (-)	Ensembl				GRCr8
mRatBN7.2	16	69,403,215 - 69,406,580 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	69,402,989 - 69,406,580 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	74,676,916 - 74,680,281 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	78,108,488 - 78,111,869 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	73,357,687 - 73,361,068 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	74,260,551 - 74,264,142 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	74,260,551 - 74,264,142 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	73,893,385 - 73,896,976 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	73,888,290 - 73,891,881 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	67,295,927 - 67,299,518 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

DKK4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	42,374,063 - 42,391,322 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	42,374,063 - 42,377,229 (-)	Ensembl			hg38	GRCh38
GRCh37	8	42,231,581 - 42,234,747 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	42,350,743 - 42,353,831 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	42,350,743 - 42,353,830	NCBI
Celera	8	41,176,301 - 41,179,389 (-)	NCBI		Celera
Cytogenetic Map	8	p11.21	NCBI
HuRef	8	40,754,805 - 40,757,893 (-)	NCBI		HuRef
CHM1_1	8	42,278,494 - 42,281,582 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	42,644,359 - 42,661,636 (-)	NCBI		T2T-CHM13v2.0

Dkk4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	23,113,701 - 23,117,563 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	23,114,059 - 23,117,563 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	22,623,685 - 22,628,018 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	22,624,043 - 22,627,547 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	23,734,515 - 23,738,019 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	24,089,588 - 24,093,092 (+)	NCBI		MGSCv36	mm8
Celera	8	24,114,227 - 24,117,730 (+)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	11.42	NCBI

DKK4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	60,824,615 - 60,846,740 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	36,541,571 - 36,563,694 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	41,618,173 - 41,638,550 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	39,062,711 - 39,082,575 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	39,062,711 - 39,082,575 (-)	Ensembl			panPan2	panpan1.1

DKK4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	23,302,124 - 23,304,824 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	23,302,320 - 23,304,834 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	23,806,606 - 23,809,696 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	25,050,668 - 25,053,758 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	25,050,610 - 25,053,352 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	23,421,837 - 23,424,927 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	23,984,745 - 23,987,836 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	24,035,535 - 24,038,626 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dkk4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	46,362,345 - 46,366,872 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936785	319,494 - 323,055 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936785	319,494 - 323,226 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DKK4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	11,390,206 - 11,394,436 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	11,389,551 - 11,394,754 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	12,989,140 - 12,992,439 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DKK4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	40,370,299 - 40,386,835 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	40,370,336 - 40,373,264 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666052	1,409,996 - 1,414,393 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dkk4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624780	880,285 - 883,520 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624780	873,669 - 884,091 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dkk4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	13	63,803,549 - 63,806,420 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dkk4
45 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	327
Count of miRNA genes:	189
Interacting mature miRNAs:	208
Transcripts:	ENSRNOT00000026067
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	44455123	89455123	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	59428714	91442908	Rat
1298529	Arunc1	Aerobic running capacity QTL 1	4		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	34398294	79398294	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	36928782	81928782	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	31885271	76885271	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	41992064	86992064	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	44455123	89455123	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	59428714	91442908	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	59428714	91442908	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	49099196	91442908	Rat
1298527	Arunc2	Aerobic running capacity QTL 2	2.9		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	75235285	81732231	Rat
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	32361043	77361043	Rat

Markers in Region

RH130718

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	69,404,421 - 69,404,619 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	74,261,984 - 74,262,181	NCBI	Rnor6.0
Rnor_5.0	16	73,894,818 - 73,895,015	UniSTS	Rnor5.0
RGSC_v3.4	16	73,889,723 - 73,889,920	UniSTS	RGSC3.4
Celera	16	67,297,360 - 67,297,557	UniSTS
RH 3.4 Map	16	664.21	UniSTS
Cytogenetic Map	16	q12.5	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	35	116	58	58	27	92	27	6	265	160	11	95	54	73	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109332	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026067 ⟹ ENSRNOP00000026067

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	76,105,679 - 76,109,044 (-)	Ensembl
mRatBN7.2 Ensembl	16	69,402,989 - 69,406,580 (-)	Ensembl
Rnor_6.0 Ensembl	16	74,260,551 - 74,264,142 (-)	Ensembl

RefSeq Acc Id:

NM_001109332 ⟹ NP_001102802

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	76,105,679 - 76,109,044 (-)	NCBI
mRatBN7.2	16	69,403,215 - 69,406,580 (-)	NCBI
Rnor_6.0	16	74,260,551 - 74,264,142 (-)	NCBI
Rnor_5.0	16	73,893,385 - 73,896,976 (-)	NCBI
RGSC_v3.4	16	73,888,290 - 73,891,881 (-)	RGD
Celera	16	67,295,927 - 67,299,518 (-)	RGD

Sequence:

show sequence

ACACACCTTCCTTGGGCAGATTCTCTTTCAGAAAAGGCCTCTGTGGGCAACTTGCAGATCGTGC
CTAGGACCACTCAGCAGCCCAGCCTTAGAAGACTCAAGCGGTTCTGGAACTCCCGAGAGACCAG
AGTGACTGAAGGATGGTCCTGGTGGCCTTGCTTGGACTCAGCTGGTTCTGTTCACCCCTGGGAG
CCCTGGTTCTGGATTTTAACAACATCAAGAGCTCCTCAGATGTGCAAGGCTCTGGGAAGGGCTC
ACAGTGTGTGTCAGACAAGGATTGCAACGTAGGAAAATTCTGCTTCGCGCTCCATGATGAAAGG
TCCTTCTGTGCCACGTGCCGCAGAGTTCGCAGGAGATGCCAGAGGAGCGCCATGTGCTGCCCAG
GAACGGTCTGCGTGAATGATGTTTGCACTGCAGTGGAAAACACGAGGCCAGTGATGGACAGAAA
CACCGACGGCCAAGATGGCACCTACGCAGAGGGAACCACCAAATGGCCAGCGGAGGAAAACAGA
CCTCAGGGGAAGCCCAGTACGAAGAAATCACAAAGCAATAAGGGACAGGAGGGAGAAAGCTGTC
TCAGAACCTCCGACTGCGGCCCTGGACTTTGCTGTGCTCGCCATTTTTGGACCAAAATTTGCAA
GCCAGTTCTACTAGAGGGACAAGTGTGTTCCAGGAGGGGGCACAAAGACACTGCCCAAGCCCCA
GAAATCTTCCAGCGCTGTGACTGTGGTCCTGGACTGTCCTGTCGAAGTCAGGTGACTGGTAACC
GACAACATACAAGGCTAAGAGTATGCCAAAGAATATAAGTTGTACAGACATGGGACTTGTCCTC
GTGTTCACACAGAATCCCTGGCACTAATTTTATTCTATTTTTTATTTTGTTTTCTGAGACAGTG
GTCTCGCTGTGTAGCCCTGGCTGGCCTTACACTCATAGAGACCCACCTGCCTCTGCCTCCTGGA
TAATTTTTGGGGGGAGGGGTAAGGGTTCTGAGACAGGGTCTCAGAGTAAGCTATATAGCCCAGG
GTGGCTTCGAACTCATGTTCCTCTTGCCTCGAGTGAGTCTTGGGATTACAGGCAAGTACATTAT
ACCCAGCACATAAATAAAGCTGAATCTTCTAGCAACTGACAGTGACCAGACGCTGTGATGAGTT
ACTTCTGACTTTGTGACTACCATCTACAACATGACAGGACTCTACAATAAAGCCATCCAGACAC
AGTGGCTCAATCTGCTCAAATAAATCTTTCTTAAAACTTGAAGTTCTTTGTTCGTGTACAGAAT
GTTATTTGATAAACAGTGGACTGTCCACCAGACGAACTGATGAATGCTATTATCAGTATACACT
GCAAATGGGAAATGGTCACAGAAAGTCCTTACAGCTATGAAGGCCCCTTTCTTTTTAGATAGGG
CCTCACTATGTAGCTCTGGCACCCTGGAATTCAGTATGTAGTCTGGGCTGGCCTTGAACTCACA
GAGATCTGCCTGTCTCTGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102802	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM09008	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026067
	ENSRNOP00000026067.2

RefSeq Acc Id:	NP_001102802 ⟸ NM_001109332
- Peptide Label:	precursor
- UniProtKB:	D4ADQ6 (UniProtKB/TrEMBL), A6IW64 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVLVALLGLSWFCSPLGALVLDFNNIKSSSDVQGSGKGSQCVSDKDCNVGKFCFALHDERSFCA TCRRVRRRCQRSAMCCPGTVCVNDVCTAVENTRPVMDRNTDGQDGTYAEGTTKWPAEENRPQGK PSTKKSQSNKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQ RCDCGPGLSCRSQVTGNRQHTRLRVCQRI hide sequence

Ensembl Acc Id:

ENSRNOP00000026067 ⟸ ENSRNOT00000026067

Protein Domains

Dickkopf N-terminal cysteine-rich Dickkopf-related protein 1/2/4 C-terminal subdomain

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ADQ6-F1-model_v2	AlphaFold	D4ADQ6	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563172	AgrOrtholog
BioCyc Gene	G2FUF-10879	BioCyc
Ensembl Genes	ENSRNOG00000019267	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026067	ENTREZGENE
	ENSRNOT00000026067.5	UniProtKB/TrEMBL
Gene3D-CATH	Lipase, subunit A	UniProtKB/TrEMBL
InterPro	Dickkopf_N	UniProtKB/TrEMBL
	DIKK1/2/4_C-subdom1	UniProtKB/TrEMBL
	DIKK1/2/4_C-subdom2	UniProtKB/TrEMBL
	DKK-like	UniProtKB/TrEMBL
	Dkk4_Cys2	UniProtKB/TrEMBL
KEGG Report	rno:502097	UniProtKB/TrEMBL
NCBI Gene	502097	ENTREZGENE
PANTHER	DICKKOPF-RELATED PROTEIN 4	UniProtKB/TrEMBL
	PTHR12113	UniProtKB/TrEMBL
Pfam	Dickkopf_N	UniProtKB/TrEMBL
	DIKK1-2-4_C-subdom1	UniProtKB/TrEMBL
	DIKK1-2-4_C-subdom2	UniProtKB/TrEMBL
PhenoGen	Dkk4	PhenoGen
RatGTEx	ENSRNOG00000019267	RatGTEx
UniProt	A6IW64	ENTREZGENE, UniProtKB/TrEMBL
	D4ADQ6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-22	Dkk4	dickkopf WNT signaling pathway inhibitor 4	Dkk4	dickkopf homolog 4 (Xenopus laevis)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Dkk4	dickkopf homolog 4 (Xenopus laevis)	RGD1563172_predicted	similar to Dickkopf homolog 4 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1563172_predicted	similar to Dickkopf homolog 4 (predicted)	LOC502097	similar to Dickkopf homolog 4	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC502097	similar to Dickkopf homolog 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)