Advanced Search (OLGA)

Gene: Trat1 (T cell receptor associated transmembrane adaptor 1) Rattus norvegicus

Analyze

Symbol:

Trat1

Name:

T cell receptor associated transmembrane adaptor 1

RGD ID:

1563011

Description:

Predicted to be involved in negative regulation of receptor recycling and positive regulation of T cell receptor signaling pathway. Predicted to act upstream of or within negative regulation of transport and positive regulation of calcium-mediated signaling. Predicted to be located in centriolar satellite; mitotic spindle; and plasma membrane. Predicted to be part of T cell receptor complex. Orthologous to human TRAT1 (T cell receptor associated transmembrane adaptor 1); INTERACTS WITH alpha-Zearalanol; atrazine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC125004; similar to T cell receptor interacting molecule

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	65,498,742 - 65,540,823 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	65,498,742 - 65,542,381 (+)	Ensembl				GRCr8
mRatBN7.2	11	52,035,750 - 52,077,805 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	52,035,750 - 52,077,805 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	60,798,860 - 60,840,951 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	53,460,643 - 53,502,744 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	52,565,480 - 52,607,541 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	54,619,169 - 54,661,284 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	54,619,129 - 54,662,353 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	57,780,653 - 57,820,982 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	53,279,300 - 53,321,892 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	51,634,708 - 51,676,239 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-palmitoylglycerol (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

asbestos (ISO)

atrazine (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cannabidiol (ISO)

CGP 52608 (ISO)

diclofenac (ISO)

dimethylarsinic acid (ISO)

fenvalerate (EXP)

fulvestrant (ISO)

lead diacetate (ISO)

methylarsonic acid (ISO)

nickel atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

streptozocin (ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of receptor recycling (IBA,ISO)

negative regulation of transport (ISO)

positive regulation of calcium-mediated signaling (ISO)

positive regulation of T cell receptor signaling pathway (IBA,ISO)

Cellular Component

centriolar satellite (IEA,ISO)

plasma membrane (IEA,ISO)

T cell receptor complex (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11390434

Genomics

Comparative Map Data

Trat1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	65,498,742 - 65,540,823 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	65,498,742 - 65,542,381 (+)	Ensembl				GRCr8
mRatBN7.2	11	52,035,750 - 52,077,805 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	52,035,750 - 52,077,805 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	60,798,860 - 60,840,951 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	53,460,643 - 53,502,744 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	52,565,480 - 52,607,541 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	54,619,169 - 54,661,284 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	54,619,129 - 54,662,353 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	57,780,653 - 57,820,982 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	53,279,300 - 53,321,892 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	51,634,708 - 51,676,239 (+)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

TRAT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	108,822,786 - 108,855,005 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	108,822,770 - 108,855,005 (+)	Ensembl			hg38	GRCh38
GRCh37	3	108,541,633 - 108,573,852 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	110,024,321 - 110,056,404 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	110,024,320 - 110,056,404	NCBI
Celera	3	106,939,375 - 106,971,458 (+)	NCBI		Celera
Cytogenetic Map	3	q13.13	NCBI
HuRef	3	105,915,273 - 105,947,371 (+)	NCBI		HuRef
CHM1_1	3	108,505,620 - 108,537,674 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	111,543,021 - 111,575,233 (+)	NCBI		T2T-CHM13v2.0

Trat1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	48,551,137 - 48,630,883 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	48,551,137 - 48,592,384 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm39 Ensembl	16	48,595,767 - 48,637,156 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	48,730,774 - 48,810,547 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	48,730,774 - 48,772,021 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	48,734,803 - 48,772,069 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	48,651,536 - 48,691,761 (-)	NCBI		MGSCv36	mm8
Celera	16	49,095,445 - 49,132,938 (-)	NCBI		Celera
Cytogenetic Map	16	B5	NCBI
cM Map	16	30.75	NCBI

LOC102018114
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	9,665,456 - 9,699,788 (+)	Ensembl
ChiLan1.0	NW_004955427	9,665,479 - 9,700,305 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100990994
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	106,800,505 - 106,833,301 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	106,805,284 - 106,838,080 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	105,948,998 - 105,981,111 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	112,879,399 - 112,911,668 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	112,879,355 - 112,911,668 (+)	Ensembl			panPan2	panpan1.1

TRAT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	14,033,597 - 14,068,309 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	14,033,657 - 14,067,974 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	14,139,060 - 14,175,773 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	14,199,408 - 14,237,150 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	14,199,468 - 14,235,554 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	14,068,627 - 14,103,302 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	14,135,794 - 14,173,516 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	14,547,404 - 14,584,144 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101972231
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	140,353,838 - 140,386,098 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936645	2,464,548 - 2,491,016 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936645	2,459,524 - 2,491,016 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRAT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	150,629,944 - 150,666,598 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	150,629,942 - 150,666,842 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	159,760,124 - 159,796,220 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TRAT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	71,939,447 - 71,972,187 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	71,939,207 - 71,972,172 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	94,493,792 - 94,526,013 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101706523
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	40,280,884 - 40,306,653 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624731	40,281,086 - 40,319,254 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

LOC116898310
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	33,247,034 - 33,263,682 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Trat1
317 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	344
Count of miRNA genes:	203
Interacting mature miRNAs:	235
Transcripts:	ENSRNOT00000059924
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat

Markers in Region

RH130838

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	11	65,540,545 - 65,540,763 (+)	Marker Load Pipeline
mRatBN7.2	11	52,077,527 - 52,077,745 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	54,661,007 - 54,661,224	NCBI	Rnor6.0
Rnor_5.0	11	57,820,705 - 57,820,922	UniSTS	Rnor5.0
RGSC_v3.4	11	53,321,615 - 53,321,832	UniSTS	RGSC3.4
Celera	11	51,675,962 - 51,676,179	UniSTS
Cytogenetic Map	11	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
14	7	27	54	52	52	22	92	22	6	232	137	6	31	53	55	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC111081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000059924 ⟹ ENSRNOP00000056668

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	65,498,764 - 65,541,637 (+)	Ensembl
mRatBN7.2 Ensembl	11	52,035,750 - 52,077,805 (+)	Ensembl
Rnor_6.0 Ensembl	11	54,619,129 - 54,662,353 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130061 ⟹ ENSRNOP00000101516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	65,498,742 - 65,542,381 (+)	Ensembl

RefSeq Acc Id:

NM_001037981 ⟹ NP_001033070

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	65,498,742 - 65,540,823 (+)	NCBI
mRatBN7.2	11	52,035,750 - 52,077,805 (+)	NCBI
Rnor_6.0	11	54,619,169 - 54,661,284 (+)	NCBI
Rnor_5.0	11	57,780,653 - 57,820,982 (+)	NCBI
RGSC_v3.4	11	53,279,300 - 53,321,892 (+)	RGD
Celera	11	51,634,708 - 51,676,239 (+)	RGD

Sequence:

show sequence

GAACAAACTACACACAAAAGAGTTAAAGAAACAGCGGAGAAAAAAAAAACACCTGAGTACAGAT
AAAGATATATGTTGGTGCTGTGCTGTTTCTAACATAACAGAACAACGGTACTTAAGGAAAAAAG
CTGGTGGGAGAATTCTTAGCCTACCAATCTGTTTCATGGCTGCACACAGGTTCTTCTAAAAAGA
CAAGCATGTCAGGAAACTCTGGATGCCCCTTCTTCCTCTGGGGACTTCTAGCCTTCTTGGGCTT
GGCTCTGGTCATATCGTTGATCTTCAATGTTTCCCACTATGTAGAGAAGCAGCGACGAGATAAA
ATGTACAGATACTCTGATGACTACATTCCAAGGGCTGAAGAATATTATGAAGATGCTCCAATTT
ATGGTAACTTAGAAAATATCATCCCTGAACCACTGGACGAAGACTGCTATGAGCAAATGAAAGC
TCGACCACAGAGATCTGCAAGTGACGCACAGGAAGTGGTTGCACCTGCACAGGTACCTGCTGAA
GCTCAAATTTGCTATGCCTCACTGGATCACAGCATGAAGGGGAAACGCAGAAGGCCCAGGAAAC
AGAATACTAATTTGTCAGACAGAGGAAAGGATGCACAAGACTGTACAATGGGTGCCAACGTTTC
TCAGAACAATATGGTAGAAAGTTTTCCACCAGATAACCAGGTAGTTGAGGAAAGTATTCATGAT
GATCCTGCTAGACTGTTTGGATTGATCCGGGCCAAGAGAGAACCTGTAATCTAGCTGGACTATA
ATTCAGCTCAATGGTAACACCCTTTGAGAGATGGTTGAAAAAGCAAGATTACCATGTGACACAC
AGGGATTGACAGAGTGACAGTCTACTCATTTTTCAGCGGAATGGTACCTTCCTTTGTCTTTATG
GATCACATCCCTACACACTAAATCTAATTATAATTAGCTATATGAATACAGTTAAGAATATCTA
AATAGAAAAAGTCAGATAATAAAGTCCAGTTTGCAACTTAAATGACTTGATAACAAAATCAAAA
TGAACAGTAATACCTAATAAGGACAAAGTTTTAAAAATTCAAAGTACATAGGACACCTTGAATG
AAAGAGAAAAGCCTGTGTCTTAAAAAATTATCAATAAAACATGTCTTCTTTCATCAATGTGAAT
AAGTAATTAGAAGAAATTTCTGATTGAAAGTACACTGCCAAGGAAAGTAGAGTAATCGTGAGGA
GTATTGTTTCCAAGATGTAAATAGTATTATTAGTTTTAAAATTGTTATAAAAATAAATCCATGC
TTTTTACAACAATTAAAAAGGTAAGAACTTAGAAAATTCTACTACTCAGAGATAATCAATATGA
ATAACTTCTTTGTGTTTATGGATATTTGACTGGACGTAACCATCTATATGTAACAGCTTTTCCT
TTTCCTGTTTTAAATTAAACATAGAGAATTATGAATATTATTTAAATTCTATTTGTGTATCAAC
AGAGTAGGAATTATTTCTACTATATATTACTATATTAAAATGTCTTCAATTTTGTATTTGATGA
TGCTGGGAAGCAAACACGGAGTCTTTCAGATGAAAGACAAGTACCTCACCACTGAGCTTCATCC
AAACTCTGCTTCATAATTCTAACATCTGCATTGTATCTCATTTACGATTAAATCAGAATCCATT
TAAAGGAGTTTGAAGACTACTTAAATGAACTCAAGTTTCCATTTTATGGAATATTTATGGAATA
TTTTAATGAGAATGTTCAAAGGCATGACTGGATACTTATCTAGTTTCTTCTTTGTGTTAAGCAT
TTAAAAGGGAATTAAATATTTAAAGATGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001033070	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI11082	(Get FASTA)	NCBI Sequence Viewer
	EDM11111	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000056668
	ENSRNOP00000056668.2
	ENSRNOP00000101516.1

RefSeq Acc Id:	NP_001033070 ⟸ NM_001037981
- UniProtKB:	F7F6T0 (UniProtKB/TrEMBL), A6IQV8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSGNSGCPFFLWGLLAFLGLALVISLIFNVSHYVEKQRRDKMYRYSDDYIPRAEEYYEDAPIYG NLENIIPEPLDEDCYEQMKARPQRSASDAQEVVAPAQVPAEAQICYASLDHSMKGKRRRPRKQN TNLSDRGKDAQDCTMGANVSQNNMVESFPPDNQVVEESIHDDPARLFGLIRAKREPVI hide sequence

Ensembl Acc Id:

ENSRNOP00000056668 ⟸ ENSRNOT00000059924

Ensembl Acc Id:

ENSRNOP00000101516 ⟸ ENSRNOT00000130061

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7F6T0-F1-model_v2	AlphaFold	F7F6T0	1-186	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563011	AgrOrtholog
BioCyc Gene	G2FUF-21420	BioCyc
Ensembl Genes	ENSRNOG00000029564	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000059924	ENTREZGENE
	ENSRNOT00000059924.4	UniProtKB/TrEMBL
	ENSRNOT00000130061.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7384735	IMAGE-MGC_LOAD
InterPro	T-cell_rcpt-assoc_TM_adapter-1	UniProtKB/TrEMBL
KEGG Report	rno:498075	UniProtKB/TrEMBL
MGC_CLONE	MGC:125004	IMAGE-MGC_LOAD
NCBI Gene	498075	ENTREZGENE
PANTHER	PTHR15951	UniProtKB/TrEMBL
	T-CELL RECEPTOR-ASSOCIATED TRANSMEMBRANE ADAPTER 1	UniProtKB/TrEMBL
Pfam	SIT	UniProtKB/TrEMBL
PhenoGen	Trat1	PhenoGen
RatGTEx	ENSRNOG00000029564	RatGTEx
UniProt	A0ABK0LI62_RAT	UniProtKB/TrEMBL
	A6IQV8	ENTREZGENE, UniProtKB/TrEMBL
	F7F6T0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Trat1	T cell receptor associated transmembrane adaptor 1	MGC125004	similar to T cell receptor interacting molecule	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	MGC125004	similar to T cell receptor interacting molecule			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message