Advanced Search (OLGA)

Gene: Pot1 (protection of telomeres 1) Rattus norvegicus

Analyze

Symbol:

Pot1

Name:

protection of telomeres 1

RGD ID:

1562696

Description:

Predicted to enable DEAD/H-box RNA helicase binding activity; DNA binding activity; and telomerase inhibitor activity. Predicted to be involved in establishment of protein localization to telomere; regulation of DNA metabolic process; and telomere organization. Predicted to act upstream of or within chromosome organization. Predicted to be located in chromosome, telomeric region. Predicted to be part of shelterin complex. Human ortholog(s) of this gene implicated in colorectal cancer; familial melanoma; hepatocellular carcinoma; lung cancer; and ovarian cancer. Orthologous to human POT1 (protection of telomeres 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC500054; LOC500054; Pot1a; protection of telomeres 1 homolog; protection of telomeres 1 homolog (S. pombe); protection of telomeres 1A; protection of telomeres protein 1; similar to POT1-like telomere end-binding protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POT1 (protection of telomeres 1)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pot1a (protection of telomeres 1A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pot1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POT1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POT1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pot1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POT1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POT1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pot1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pot1 (protection of telomeres 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRADD (TNFRSF1A associated via death domain)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	POT1 (protection of telomeres 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pot1a (protection of telomeres 1A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pot1 (protection of telomeres 1 homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pot1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pot-2	Alliance	DIOPT (PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	55,170,821 - 55,228,588 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	55,170,821 - 55,228,543 (-)	Ensembl				GRCr8
mRatBN7.2	4	54,205,330 - 54,263,137 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	54,205,332 - 54,263,042 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	59,206,940 - 59,263,878 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	55,120,524 - 55,177,464 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	53,525,039 - 53,581,975 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	51,888,632 - 51,946,764 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	51,888,634 - 51,946,715 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	51,664,672 - 51,722,749 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	52,233,404 - 52,289,574 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	49,343,691 - 49,398,232 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aplastic anemia (ISO)

Cerebroretinal Microangiopathy with Calcifications and Cysts 3 (ISO)

cholecystitis (ISO)

chromosomal disease (ISO)

Chromosome Aberrations (ISO)

colorectal cancer (ISO)

dyskeratosis congenita (ISO)

dysplastic nevus syndrome (ISO)

familial melanoma (ISO)

glioblastoma (ISO)

hepatocellular carcinoma (ISO)

Hereditary Neoplastic Syndromes (ISO)

high grade glioma (ISO)

high-grade astrocytoma with piloid features (ISO)

Hoyeraal-Hreidarsson Syndrome (ISO)

lung cancer (ISO)

lymphoid leukemia (ISO)

melanoma (ISO)

ovarian cancer (ISO)

Pulmonary Fibrosis and/or Bone Marrow Failure Syndrome, Telomere-Related, 8 (ISO)

skin melanoma (ISO)

Skin Neoplasms (ISO)

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

doxorubicin (ISO)

genistein (ISO)

glyphosate (EXP)

methyl isocyanate (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

oxaliplatin (EXP)

paracetamol (EXP)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

thioacetamide (EXP)

topotecan (EXP)

triphenyl phosphate (ISO)

troglitazone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

establishment of protein localization to telomere (ISO)

negative regulation of telomere maintenance via telomerase (ISO)

positive regulation of DNA strand elongation (ISO)

positive regulation of telomere maintenance via telomerase (ISO)

positive regulation of telomeric D-loop disassembly (ISO)

regulation of double-strand break repair via nonhomologous end joining (ISO)

regulation of telomere maintenance via telomerase (IBA,ISO)

telomere assembly (ISO)

telomere capping (IBA,ISO)

telomere maintenance (IEA)

telomere maintenance via telomerase (ISO)

telomeric D-loop disassembly (ISO)

telomeric loop formation (ISO)

Cellular Component

chromosome, telomeric region (IEA,ISO)

nuclear telomere cap complex (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA)

shelterin complex (ISO)

Molecular Function

8-hydroxy-2'-deoxyguanosine DNA binding (ISO)

DEAD/H-box RNA helicase binding (ISO)

DNA binding (IEA)

G-rich single-stranded DNA binding (ISO)

G-rich strand telomeric DNA binding (IBA,ISO)

protein binding (ISO)

single-stranded telomeric DNA binding (IEA,ISO)

small GTPase binding (IEA)

telomerase inhibitor activity (IBA,ISO)

telomeric D-loop binding (ISO)

telomeric DNA binding (IEA,ISO)

telomeric G-quadruplex DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Protection of telomeres 1 protein levels are associated with telomere length in gastric cancer.	Fujii K, etal., Int J Mol Med. 2008 May;21(5):599-604.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Genetic variation in telomere maintenance genes, telomere length, and lung cancer susceptibility.	Hosgood HD, etal., Lung Cancer. 2009 Nov;66(2):157-61. doi: 10.1016/j.lungcan.2009.02.005. Epub 2009 Mar 13.
4.	Large-scale genome-wide association study in a Japanese population identifies novel susceptibility loci across different diseases.	Ishigaki K, etal., Nat Genet. 2020 Jul;52(7):669-679. doi: 10.1038/s41588-020-0640-3. Epub 2020 Jun 8.
5.	Telomere 1 (POT1) gene expression and its association with telomerase activity in colorectal tumor samples with different pathological features.	Izgi A, etal., Biomed Pharmacother. 2014 Sep;68(7):841-6. doi: 10.1016/j.biopha.2014.08.014. Epub 2014 Aug 20.
6.	Prognostic impact of telomere maintenance gene polymorphisms on hepatocellular carcinoma patients with chronic hepatitis B.	Jung SW, etal., Hepatology. 2014 May;59(5):1912-20. doi: 10.1002/hep.26655. Epub 2014 Mar 27.
7.	Telomere structure and maintenance gene variants and risk of five cancer types.	Karami S, etal., Int J Cancer. 2016 Dec 15;139(12):2655-2670. doi: 10.1002/ijc.30288. Epub 2016 Sep 8.
8.	Telomere length variation and expression analysis of shelterin complex genes during gallbladder carcinogenesis.	Poojary SS, etal., J Cancer Res Ther. 2017 Apr-Jun;13(2):235-239. doi: 10.4103/0973-1482.184512.
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.	Telomere Maintenance Variants and Survival after Colorectal Cancer: Smoking- and Sex-Specific Associations.	Yin H, etal., Cancer Epidemiol Biomarkers Prev. 2020 Sep;29(9):1817-1824. doi: 10.1158/1055-9965.EPI-19-1507. Epub 2020 Jun 25.

Additional References at PubMed

PMID:12768206	PMID:12781132	PMID:15181449	PMID:15383534	PMID:15632080	PMID:15657433	PMID:16030011	PMID:16043710	PMID:16880378	PMID:17053789	PMID:17237767	PMID:17237768
PMID:17632522	PMID:19135898	PMID:19734539	PMID:19854130	PMID:21852327	PMID:22039056	PMID:22763445	PMID:23685356	PMID:24120135	PMID:24270157	PMID:25589350	PMID:26586433
PMID:29227966

Genomics

Comparative Map Data

Pot1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	55,170,821 - 55,228,588 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	55,170,821 - 55,228,543 (-)	Ensembl				GRCr8
mRatBN7.2	4	54,205,330 - 54,263,137 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	54,205,332 - 54,263,042 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	59,206,940 - 59,263,878 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	55,120,524 - 55,177,464 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	53,525,039 - 53,581,975 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	51,888,632 - 51,946,764 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	51,888,634 - 51,946,715 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	51,664,672 - 51,722,749 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	52,233,404 - 52,289,574 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	49,343,691 - 49,398,232 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

POT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	124,822,386 - 124,929,825 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	124,822,386 - 124,929,959 (-)	Ensembl			hg38	GRCh38
GRCh37	7	124,462,440 - 124,569,879 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	124,249,676 - 124,357,273 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	124,057,263 - 124,131,201	NCBI
Celera	7	119,267,687 - 119,375,230 (-)	NCBI		Celera
Cytogenetic Map	7	q31.33	NCBI
HuRef	7	118,827,419 - 118,935,017 (-)	NCBI		HuRef
CHM1_1	7	124,395,753 - 124,503,350 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	126,139,780 - 126,247,229 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	123,851,834 - 123,959,412 (-)	NCBI

Pot1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	25,743,939 - 25,809,280 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	25,743,736 - 25,809,245 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	25,743,940 - 25,809,277 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	25,743,737 - 25,809,246 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	25,693,735 - 25,759,226 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	25,693,745 - 25,759,236 (-)	NCBI		MGSCv36	mm8
Celera	6	25,744,313 - 25,810,007 (-)	NCBI		Celera
Cytogenetic Map	6	A3.1	NCBI
cM Map	6	11.65	NCBI

Pot1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	6,140,501 - 6,209,031 (-)	Ensembl
ChiLan1.0	NW_004955479	6,140,599 - 6,230,512 (-)	NCBI	ChiLan1.0	ChiLan1.0

POT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	161,671,016 - 161,789,306 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	13,677,851 - 13,799,556 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	116,807,913 - 116,926,998 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	129,487,571 - 129,605,558 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	129,487,571 - 129,605,558 (-)	Ensembl			panPan2	panpan1.1

POT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	10,987,385 - 11,067,473 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	10,987,494 - 11,066,956 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	10,683,957 - 10,766,907 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	10,769,382 - 10,849,644 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	10,769,491 - 10,849,644 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	10,960,833 - 11,041,479 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	10,693,633 - 10,773,611 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	10,852,699 - 10,933,293 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pot1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	51,284,826 - 51,367,106 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936605	836,769 - 920,201 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936605	836,824 - 919,099 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	22,885,749 - 22,981,890 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	22,885,704 - 22,981,893 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	24,394,687 - 24,526,564 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	93,572,139 - 93,688,374 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	93,571,272 - 93,655,869 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	9,761,660 - 9,885,572 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pot1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	11,138,303 - 11,223,044 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624783	11,138,222 - 11,223,329 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pot1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	114,102,215 - 114,157,743 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pot1
350 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	115
Count of miRNA genes:	85
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000060459
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	13080146	58080146	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	35113290	80113290	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	40490442	75726188	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
10450825	Scl78	Serum cholesterol level QTL 78	3.7	0.01	blood VLDL cholesterol amount (VT:0005144)	blood low density lipoprotein cholesterol level (CMO:0000053)	4	50143926	58080146	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
10450821	Scl77	Serum cholesterol level QTL 77	4.1	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	50143926	58080146	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	37269577	82269577	Rat
10450818	Scl76	Serum cholesterol level QTL 76	3.6	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	50143926	58080146	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	40471453	75939996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	27862204	62997402	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001395151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001395152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010065689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010065690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_353175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC090024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000060459 ⟹ ENSRNOP00000057203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	55,170,823 - 55,225,352 (-)	Ensembl
mRatBN7.2 Ensembl	4	54,205,332 - 54,259,856 (-)	Ensembl
Rnor_6.0 Ensembl	4	51,888,634 - 51,943,519 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079130 ⟹ ENSRNOP00000070115

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	55,170,821 - 55,228,543 (-)	Ensembl
mRatBN7.2 Ensembl	4	54,205,334 - 54,259,851 (-)	Ensembl
Rnor_6.0 Ensembl	4	51,888,949 - 51,946,715 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080575 ⟹ ENSRNOP00000070503

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	54,209,367 - 54,263,042 (-)	Ensembl
Rnor_6.0 Ensembl	4	51,892,065 - 51,931,112 (-)	Ensembl

RefSeq Acc Id:

NM_001395151 ⟹ NP_001382080

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	55,170,821 - 55,228,543 (-)	NCBI
mRatBN7.2	4	54,205,330 - 54,263,047 (-)	NCBI

RefSeq Acc Id:

NM_001395152 ⟹ NP_001382081

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	55,170,821 - 55,228,543 (-)	NCBI
mRatBN7.2	4	54,205,330 - 54,263,047 (-)	NCBI

RefSeq Acc Id:

XM_008762811 ⟹ XP_008761033

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	55,170,821 - 55,228,586 (-)	NCBI
mRatBN7.2	4	54,205,330 - 54,263,137 (-)	NCBI
Rnor_6.0	4	51,888,632 - 51,946,764 (-)	NCBI

Sequence:

show sequence

GGAGTACGCATGCGTGTGCTCAGCGGCTCGAGCCCGCGCGCGCGCATGACGTCATGGGCGCGTC
AATGCAGACCTTAGTTGTCCGCGGGTCTTGCTGGGAAAACTCAGTTGTTCTTAATGCCTTGCGG
AAGTAAAACAGCTGTTTTGAAGATTAGACTTTGAGGTTCCGGTAACTCCCTATACATATACACC
CCTGAATCTACTTAAGGAAGGTGCAGTTGCCAATGTCTATGGTGTTGTGAAATTCTTTAAGCCT
CCATATCTCAGCAAAGGAACTGATTATTGCTCAGTTGTAACAATTGTGGACCCAACAAATGTGA
AGTTAACGTGCATGCTCTTTAGTGGAAACTATGAAGCCCTTCCGATCATTTACAAAGTTGGAGA
CATTGTTCGCTTCCATAGGCTGAAGATCCAAGTATATAAAAATGAGCTTCAGGGAATCAACAGC
TCTGGGTTCGCGTCTTTGACATTTGAAGGAACATTAGGGACACCTGTCACAGCACGTACTTCAA
GCAAAGTTTTTAGCTTCACTTCTCAGGACCAAAAAATGGTAGAAGCTTTGCGAGTTTGGGCATC
CAAGCACATTGCAGCTTCTTCAAGTTTAGTGCAGCTGTGTGACGCTCAGCCCCTGCAATATTAT
GACCTGACCTGTCAGCTTCTGGGTAAAGCAGAAGTGGATGGAACAGCCTTTCTTCTAAAGGTAT
GGGACGGAACCAGGACTATGTTTCCCTCTTGGAGAGTCTCCATACAAAATCTTACCTTTGAAGG
TGACTTGAGTCACATTCAGCGGCTACAGAGTCTGGTGATAGACATTCTAGTCTATGACAATCAT
GTTCAAGTGGCAAAATCCCTCAAGATTGGAAGCTTTATTCGAATCTATAGCCTCCATACCAAAC
TTCAGTCTGTTGATTCAGAAACCAGCAAGTCATTGTTAAGGCTGGAGTTTCATCTCCATGGAGG
GACCAGTTATGGTCGGGGGATTAGGGTTTTGCCAGATGAAAGCTCGTGTGTGGATCAGCTGAAA
AAAGATTTAGAATGTGCAGATTCGGCAGTCACTCAACCCTCAAATGGTATCTGTCAATCAAAAA
ATGAGGATAGCTTTGTACTTTCAAGCTCTGCATCAGGCTCAGTATCCCTGTATGAGGAAGAACG
ATGTCAGCAAGTCTCTTCTACAATACTCACAGATCACCAGCACTTAGAGAAAACTCCATTGTGT
GCCGTTTTGAAGCAAAAGGCTCCGCAGCAATATCGGGTCCGTGCCAAGCTGAGGTCGTATTTGC
CCAGGAGACTTCCCCAGTCTGTTAAACTGATCTGTCCGCAGTGCCATTCACTACAAGAAGTTCC
ACATGAGGACAGTTTGGATAAACTTTTGCAAGATGCTGCAACTAAAGCGCCAGACATCAGGCTG
CAAGGTACATCTTTGTATGAATCAAAGATCTGGACCACCGAAGGCCAGGGAGGACGGCAGGTCG
CTGTTCACTTTGTGAAGAAGGATGGTGTTCTCCCACTTTCAAGTGAATGTCTAATTTTGATAGA
AGGAGGAAGACTCTGTGAAGTGTCCAAGCTGTCCAGCAAGTTCCACAGTGTGATCCCTGTGAGG
TCCGGCCCTGAGGATCTGGAGCTCCTCGACATTTCAGCCCCATTCCTCATACAGGGAAAGCTGC
ATCACTATGGATGTAAACAGTGTTCAAGCTTGAAACCTATACAAAACCTAAATTCCCTTCTTAA
TAAAGGACCATGGATTCCTTCCTCCGTGGCAAAAGTCCTGGGCATTGTGCCTCTGCAGTATGTG
TTTGTTATGACGTTCACTCTGGATGATGGAACAGGAGTGTTGGACACTTACCTCAAGGATTCTG
AAAACTTTTTCAAGATCCCAGCATCTGAAGTCCTCACTGATGACAACCTTCAGAGGAATCTGGA
AGCGATCATGGATATGATATGCCCTCCTGGAATAAAAGTTGATGCATACCCGTGGCTTGAGTGC
CTCATCAAGTCCTACAATGTCACCATTGGAACAGAACAACGAATTTGCTACCAGATTTTTGACA
CCACGGTTGCAGAAGATGTCTAGTGCTGCCATTCAGTGCAGTGTGTATGGATTTTACAATTTTA
GAAAAGGTCATGACTCTGAGATTCTCAGAAGACACTTGGCTATTGTCAAAAGTATTGTATCCAT
TTTCACTGTAGTTCTTTTGTACAGAAAACTATTTTGTTATTTATGCCATCTTGTGAACATGTCA
GAAATCCCTTGCTGCTCATCATGTCCCAGGGAGTATAAAATGAGACAGCACTGGTTGGGGAGAA
TGCCCACTCTCATTTTTAAAACACTGGTAGCAACTTCTCCTTCTGTGCTGTTTGATTCTTTTTT
TTTTTTTTTTTTTGTACAGAAGAATCTGCTTAGCAACTTCTGAAAGAATTCTCCCTCTACTTCC
ACACATGAGTATCAGGTTAACTGAGTGCTTGTTGAACAGATGCCGTCTCACCAAGCGGGGATAT
ACTAAAAGGAGGGTTTCCTTTCAGAAGACATGGCTTTGTTTGGGTGCTCTTGATGCCCATTTCA
GGATAAATGTATCTCTTTGAACCAAATAGTATGCGTGACTTTCTGCTTCTCTCTGGAATACTAG
AAGCTATTTAATTTCATACCAACTAATAAAGTGATAGGATTTATATTTTCATGAA

hide sequence

RefSeq Acc Id:

XM_063286481 ⟹ XP_063142551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	55,170,821 - 55,228,588 (-)	NCBI

RefSeq Acc Id:

XR_010065689

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	55,172,537 - 55,228,588 (-)	NCBI

RefSeq Acc Id:

XR_010065690

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	55,172,488 - 55,228,588 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001382080	(Get FASTA)	NCBI Sequence Viewer
	NP_001382081	(Get FASTA)	NCBI Sequence Viewer
	XP_008761033	(Get FASTA)	NCBI Sequence Viewer
	XP_063142551	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85834	(Get FASTA)	NCBI Sequence Viewer
	EDM15184	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000057203.2
	ENSRNOP00000070115
	ENSRNOP00000070115.1
	ENSRNOP00000070503.3

RefSeq Acc Id:	XP_008761033 ⟸ XM_008762811
- Peptide Label:	isoform X2
- UniProtKB:	A0A0G2JY35 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINSSGFASLTFEGTLGTPVTARTSSKVF SFTSQDQKMVEALRVWASKHIAASSSLVQLCDAQPLQYYDLTCQLLGKAEVDGTAFLLKVWDGT RTMFPSWRVSIQNLTFEGDLSHIQRLQSLVIDILVYDNHVQVAKSLKIGSFIRIYSLHTKLQSV DSETSKSLLRLEFHLHGGTSYGRGIRVLPDESSCVDQLKKDLECADSAVTQPSNGICQSKNEDS FVLSSSASGSVSLYEEERCQQVSSTILTDHQHLEKTPLCAVLKQKAPQQYRVRAKLRSYLPRRL PQSVKLICPQCHSLQEVPHEDSLDKLLQDAATKAPDIRLQGTSLYESKIWTTEGQGGRQVAVHF VKKDGVLPLSSECLILIEGGRLCEVSKLSSKFHSVIPVRSGPEDLELLDISAPFLIQGKLHHYG CKQCSSLKPIQNLNSLLNKGPWIPSSVAKVLGIVPLQYVFVMTFTLDDGTGVLDTYLKDSENFF KIPASEVLTDDNLQRNLEAIMDMICPPGIKVDAYPWLECLIKSYNVTIGTEQRICYQIFDTTVA EDV hide sequence

Ensembl Acc Id:

ENSRNOP00000070115 ⟸ ENSRNOT00000079130

Ensembl Acc Id:

ENSRNOP00000070503 ⟸ ENSRNOT00000080575

Ensembl Acc Id:

ENSRNOP00000057203 ⟸ ENSRNOT00000060459

RefSeq Acc Id:	NP_001382081 ⟸ NM_001395152
- UniProtKB:	A0A0G2JX31 (UniProtKB/TrEMBL), A6IE97 (UniProtKB/TrEMBL), A0A0G2JY35 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001382080 ⟸ NM_001395151
- UniProtKB:	A0A0G2JX31 (UniProtKB/TrEMBL), A6IE97 (UniProtKB/TrEMBL), A0A0G2JY35 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063142551 ⟸ XM_063286481
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JX31 (UniProtKB/TrEMBL), A6IE97 (UniProtKB/TrEMBL), A0A0G2JY35 (UniProtKB/TrEMBL)

Protein Domains

Telomeric single stranded DNA binding POT1/Cdc13

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JX31-F1-model_v2	AlphaFold	A0A0G2JX31	1-638	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692917

Promoter ID:

EPDNEW_R3433

Type:

multiple initiation site

Name:

Pot1_1

Description:

protection of telomeres 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	51,946,711 - 51,946,771	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562696	AgrOrtholog
BioCyc Gene	G2FUF-45462	BioCyc
Ensembl Genes	ENSRNOG00000019986	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000047439	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000060459.5	UniProtKB/TrEMBL
	ENSRNOT00000079130	ENTREZGENE
	ENSRNOT00000079130.3	UniProtKB/TrEMBL
	ENSRNOT00000080575.3	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.140	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7134840	IMAGE-MGC_LOAD
InterPro	NA-bd_OB-fold	UniProtKB/TrEMBL
	POT1	UniProtKB/TrEMBL
	POT1_C_insert	UniProtKB/TrEMBL
	POT1PC	UniProtKB/TrEMBL
	Telomer_end_bd	UniProtKB/TrEMBL
MGC_CLONE	MGC:94460	IMAGE-MGC_LOAD
NCBI Gene	500054	ENTREZGENE
PANTHER	PROTECTION OF TELOMERES PROTEIN 1	UniProtKB/TrEMBL
	PTHR14513	UniProtKB/TrEMBL
Pfam	POT1_C_insert	UniProtKB/TrEMBL
	POT1PC	UniProtKB/TrEMBL
	Telo_bind	UniProtKB/TrEMBL
PhenoGen	Pot1	PhenoGen
RatGTEx	ENSRNOG00000019986	RatGTEx
	ENSRNOG00000047439	RatGTEx
SMART	Telo_bind	UniProtKB/TrEMBL
Superfamily-SCOP	Nucleic_acid_OB	UniProtKB/TrEMBL
UniProt	A0A0G2JX31	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2JY35	ENTREZGENE, UniProtKB/TrEMBL
	A6IE97	ENTREZGENE, UniProtKB/TrEMBL
	Q5U2W8_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-31	Pot1	protection of telomeres 1	Pot1	protection of telomeres 1 homolog (S. pombe)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-02-02	Pot1	protection of telomeres 1 homolog (S. pombe)	Pot1a	protection of telomeres 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-21	Pot1a	protection of telomeres 1A	Pot1	protection of telomeres 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-21	Pot1	protection of telomeres 1A	LOC500054	similar to POT1-like telomere end-binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC500054	similar to POT1-like telomere end-binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM