Advanced Search (OLGA)

Gene: Insyn1 (inhibitory synaptic factor 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Insyn1

Name:

inhibitory synaptic factor 1

RGD ID:

1562618

Description:

Predicted to be involved in inhibitory postsynaptic potential and postsynaptic specialization organization. Predicted to be active in GABA-ergic synapse and postsynaptic density. Orthologous to human INSYN1 (inhibitory synaptic factor 1); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC501007; LOC501007; RGD1562618; similar to RIKEN cDNA 6030419C18 gene; UPF0583 protein; UPF0583 protein C15orf59 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	INSYN1 (inhibitory synaptic factor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Insyn1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Insyn1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	INSYN1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	INSYN1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Insyn1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	INSYN1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	INSYN1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Insyn1 (inhibitory synaptic factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Insyn1 (inhibitory synaptic factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	INSYN1 (inhibitory synaptic factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	insyn1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	insyn1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	67,799,989 - 67,810,685 (+)	NCBI		GRCr8
mRatBN7.2	8	58,904,153 - 58,914,850 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,904,153 - 58,914,843 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	64,434,248 - 64,444,959 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,711,788 - 62,722,499 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	60,576,491 - 60,587,203 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	63,286,841 - 63,297,080 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	63,286,773 - 63,301,914 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	63,057,200 - 63,067,436 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	62,297,849 - 62,308,113 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	58,363,873 - 58,374,137 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Insyn1	Rat	Bardet-Biedl syndrome		ISO	INSYN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bardet-Biedl syndrome	ClinVar	PMID:28492532
Insyn1	Rat	Bloom syndrome		ISO	INSYN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Insyn1	Rat	Brugada syndrome 8		ISO	INSYN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Brugada syndrome 8	ClinVar	PMID:28492532
Insyn1	Rat	colorectal cancer		ISO	INSYN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Insyn1	Rat	schizophrenia		ISO	INSYN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311
Insyn1	Rat	Tay-Sachs disease		ISO	INSYN1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tay-Sachs disease	ClinVar	PMID:1833974 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Insyn1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Insyn1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of INSYN1 mRNA	CTD	PMID:36331819
Insyn1	Rat	1-naphthyl isothiocyanate	decreases expression	EXP		6480464	1-Naphthylisothiocyanate results in decreased expression of INSYN1 mRNA	CTD	PMID:30723492
Insyn1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of INSYN1 mRNA	CTD	PMID:33387578
Insyn1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Insyn1 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Insyn1	Rat	acrylamide	affects expression	EXP		6480464	Acrylamide affects the expression of INSYN1 mRNA	CTD	PMID:28959563
Insyn1	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of INSYN1 mRNA	CTD	PMID:25378103
Insyn1	Rat	all-trans-retinoic acid	increases expression	ISO	INSYN1 (Homo sapiens)	6480464	Tretinoin results in increased expression of INSYN1 mRNA	CTD	PMID:23830798
Insyn1	Rat	benzo[a]pyrene	decreases methylation	ISO	INSYN1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of INSYN1 exon	CTD	PMID:27901495
Insyn1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of INSYN1 mRNA	CTD	PMID:25181051 and PMID:33296240
Insyn1	Rat	bisphenol A	increases expression	ISO	Insyn1 (Mus musculus)	6480464	bisphenol A results in increased expression of INSYN1 mRNA	CTD	PMID:32156529
Insyn1	Rat	cantharidin	decreases expression	ISO	Insyn1 (Mus musculus)	6480464	Cantharidin results in decreased expression of INSYN1 mRNA	CTD	PMID:36907384
Insyn1	Rat	cisplatin	multiple interactions	ISO	INSYN1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of INSYN1 mRNA	CTD	PMID:27392435
Insyn1	Rat	doxorubicin	decreases expression	ISO	INSYN1 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of INSYN1 mRNA	CTD	PMID:29803840
Insyn1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of INSYN1 mRNA	CTD	PMID:29391264
Insyn1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of INSYN1 mRNA	CTD	PMID:33387578
Insyn1	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of INSYN1 mRNA	CTD	PMID:21396975
Insyn1	Rat	lead(0)	affects expression	ISO	INSYN1 (Homo sapiens)	6480464	Lead affects the expression of INSYN1 mRNA	CTD	PMID:28903495
Insyn1	Rat	mercury dichloride	decreases expression	EXP		6480464	Mercuric Chloride results in decreased expression of INSYN1 mRNA	CTD	PMID:16507785
Insyn1	Rat	okadaic acid	increases expression	ISO	INSYN1 (Homo sapiens)	6480464	Okadaic Acid results in increased expression of INSYN1 mRNA	CTD	PMID:38832940
Insyn1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of INSYN1 mRNA	CTD	PMID:33387578
Insyn1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Insyn1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of INSYN1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of INSYN1 mRNA	CTD	PMID:36331819
Insyn1	Rat	progesterone	decreases expression	ISO	INSYN1 (Homo sapiens)	6480464	Progesterone results in decreased expression of INSYN1 mRNA	CTD	PMID:21540246
Insyn1	Rat	silicon dioxide	increases expression	ISO	INSYN1 (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of INSYN1 mRNA	CTD	PMID:23806026
Insyn1	Rat	sodium arsenite	increases expression	ISO	INSYN1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of INSYN1 mRNA	CTD	PMID:34032870
Insyn1	Rat	sotorasib	multiple interactions	ISO	INSYN1 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of INSYN1 mRNA	CTD	PMID:36139627
Insyn1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of INSYN1 mRNA	CTD	PMID:34492290
Insyn1	Rat	trametinib	multiple interactions	ISO	INSYN1 (Homo sapiens)	6480464	[sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of INSYN1 mRNA	CTD	PMID:36139627
Insyn1	Rat	triclosan	increases expression	ISO	INSYN1 (Homo sapiens)	6480464	Triclosan results in increased expression of INSYN1 mRNA	CTD	PMID:30510588
Insyn1	Rat	triptonide	increases expression	ISO	Insyn1 (Mus musculus)	6480464	triptonide results in increased expression of INSYN1 mRNA	CTD	PMID:33045310
Insyn1	Rat	valproic acid	affects expression	ISO	INSYN1 (Homo sapiens)	6480464	Valproic Acid affects the expression of INSYN1 mRNA	CTD	PMID:25979313
Insyn1	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of INSYN1 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Insyn1	Rat	chemical synaptic transmission, postsynaptic	involved_in	ISO	Insyn1 (Mus musculus)	1624291	PMID:27609886	RGD	PMID:27609886
Insyn1	Rat	chemical synaptic transmission, postsynaptic	involved_in	IEA	UniProtKB:Q8CD60 and ensembl:ENSMUSP00000082800	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Insyn1	Rat	inhibitory postsynaptic potential	involved_in	ISS	UniProtKB:Q8CD60	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Insyn1	Rat	inhibitory postsynaptic potential	involved_in	ISO	Insyn1 (Mus musculus)	1624291	PMID:27609886	RGD	PMID:27609886
Insyn1	Rat	inhibitory postsynaptic potential	involved_in	IBA	MGI:2442108 and PANTHER:PTN002698114	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Insyn1	Rat	inhibitory postsynaptic potential	involved_in	IEA	UniProtKB:Q8CD60 and ensembl:ENSMUSP00000082800	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Insyn1	Rat	postsynaptic specialization organization	involved_in	IEA	UniProtKB:Q8CD60 and ensembl:ENSMUSP00000082800	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Insyn1	Rat	postsynaptic specialization organization	involved_in	ISO	Insyn1 (Mus musculus)	1624291	PMID:31829939	RGD	PMID:31829939

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Insyn1	Rat	GABA-ergic synapse	is_active_in	IEA	UniProtKB:Q8CD60 and ensembl:ENSMUSP00000082800	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Insyn1	Rat	GABA-ergic synapse	is_active_in	ISO	Insyn1 (Mus musculus)	1624291	PMID:27609886	RGD	PMID:27609886
Insyn1	Rat	postsynaptic density	located_in	ISO	Insyn1 (Mus musculus)	1624291	PMID:27609886	RGD	PMID:27609886
Insyn1	Rat	postsynaptic density	located_in	IEA	UniProtKB:Q8CD60 and ensembl:ENSMUSP00000082800	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Insyn1	Rat	postsynaptic density	located_in	IEA	UniProtKB-SubCell:SL-0297	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Insyn1	Rat	postsynaptic density	is_active_in	IBA	MGI:2442108 and PANTHER:PTN002698114	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Insyn1	Rat	postsynaptic density	located_in	ISS	UniProtKB:Q8CD60	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Insyn1	Rat	postsynaptic specialization	is_active_in	IEA	UniProtKB:Q8CD60 and ensembl:ENSMUSP00000082800	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Insyn1	Rat	postsynaptic specialization	is_active_in	ISO	Insyn1 (Mus musculus)	1624291	PMID:27609886	RGD	PMID:27609886
Insyn1	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Insyn1	Rat	protein binding	enables	ISO	INSYN1 (Homo sapiens)	1624291	UniProtKB:O60941-5 more ...	RGD	PMID:32296183 and PMID:33961781
Insyn1	Rat	protein binding	enables	ISO	Insyn1 (Mus musculus)	1624291	UniProtKB:Q8BUV3 and PMID:27609886	RGD	PMID:27609886

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334	PMID:27609886

Insyn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	67,799,989 - 67,810,685 (+)	NCBI		GRCr8
mRatBN7.2	8	58,904,153 - 58,914,850 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	58,904,153 - 58,914,843 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	64,434,248 - 64,444,959 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	62,711,788 - 62,722,499 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	60,576,491 - 60,587,203 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	63,286,841 - 63,297,080 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	63,286,773 - 63,301,914 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	63,057,200 - 63,067,436 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	62,297,849 - 62,308,113 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	58,363,873 - 58,374,137 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

INSYN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	73,735,458 - 73,753,351 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	73,735,458 - 73,753,351 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	74,027,799 - 74,045,692 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	71,819,194 - 71,830,869 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	50,911,962 - 50,923,642 (-)	NCBI		Celera
Cytogenetic Map	15	q24.1	NCBI
HuRef	15	50,863,759 - 50,875,454 (-)	NCBI		HuRef
CHM1_1	15	74,150,102 - 74,161,795 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	71,552,818 - 71,570,722 (-)	NCBI		T2T-CHM13v2.0

Insyn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	58,395,886 - 58,407,063 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	58,395,886 - 58,407,063 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	58,488,603 - 58,499,780 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	58,488,603 - 58,499,780 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	58,336,410 - 58,347,549 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	58,286,740 - 58,297,879 (+)	NCBI		MGSCv36	mm8
Celera	9	55,722,145 - 55,759,277 (+)	NCBI		Celera
Cytogenetic Map	9	B	NCBI
cM Map	9	31.79	NCBI

Insyn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	3,857,563 - 3,867,898 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	3,857,563 - 3,867,905 (+)	NCBI	ChiLan1.0	ChiLan1.0

INSYN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	62,959,541 - 62,977,241 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	67,123,969 - 67,141,591 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	52,650,196 - 52,663,270 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	71,405,502 - 71,418,269 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	71,405,502 - 71,418,269 (-)	Ensembl	panpan1.1		panPan2

INSYN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	37,010,832 - 37,022,092 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	37,010,819 - 37,022,092 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	36,946,581 - 36,957,403 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	37,217,643 - 37,229,193 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	37,217,630 - 37,228,596 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	37,169,941 - 37,181,463 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	37,195,316 - 37,206,845 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	37,451,749 - 37,463,296 (-)	NCBI		UU_Cfam_GSD_1.0

Insyn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	115,061,222 - 115,076,145 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	32,912,369 - 32,923,660 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	32,909,285 - 32,924,208 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

INSYN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	59,665,735 - 59,677,104 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	59,663,878 - 59,680,847 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	64,341,240 - 64,357,170 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

INSYN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	9,736,631 - 9,749,169 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	9,737,950 - 9,749,062 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	131,864,226 - 131,877,970 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Insyn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	662,439 - 672,377 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	662,222 - 672,242 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Insyn1
58 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	92
Count of miRNA genes:	79
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000033397
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

RH133239

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	58,908,222 - 58,908,420 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	63,290,453 - 63,290,650	NCBI	Rnor6.0
Rnor_5.0	8	63,060,809 - 63,061,006	UniSTS	Rnor5.0
RGSC_v3.4	8	62,301,486 - 62,301,683	UniSTS	RGSC3.4
Celera	8	58,367,510 - 58,367,707	UniSTS
RH 3.4 Map	8	696.19	UniSTS
Cytogenetic Map	8	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001113791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000033397 ⟹ ENSRNOP00000031920

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	8	63,286,773 - 63,301,914 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116428 ⟹ ENSRNOP00000090146

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	58,904,153 - 58,914,843 (+)	Ensembl

RefSeq Acc Id:

NM_001113791 ⟹ NP_001107263

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	67,799,989 - 67,810,685 (+)	NCBI
mRatBN7.2	8	58,904,153 - 58,914,850 (+)	NCBI
Rnor_6.0	8	63,286,841 - 63,297,080 (+)	NCBI
Rnor_5.0	8	63,057,200 - 63,067,436 (+)	NCBI
RGSC_v3.4	8	62,297,849 - 62,308,113 (+)	RGD
Celera	8	58,363,873 - 58,374,137 (+)	RGD

Sequence:

show sequence

GGCCTCTGCCCCAACCCTCGGGGGCTGCCCTCCTCCAATCCAGTTCCCTCTCCAGCGCTGTTCACATCTGGAGCCCCCTCCACATCTGGAAGACCCTGATCACCGTCCCTCTGCTGGTTCGGCTGCAT
CTAAAGACCTCTGCCTTTGTAACTGCCTAGGAGTTGCGAGGGGATTGCTGCCTTCCCCCATCCCAAGGGCATCTCTTACCCTTAGTCCTTGCAGAATCATCCCCCTGCCTCCGCATCCAGATTCAGGC
AAAGATCAGCTCTGTACACCATTGGCACTTCAAGTCCTGGAAGCTGTTCTTGGGCCCAAGGCCCCTCCCCTTGCCCTCCTGTGTCCTCACCTTGACCCCCCCACCCCCGTCAGATTCTGTCTCCCTCT
GGGTGCTCCATCCCCCACCCAGAGGCGAGTAGGTGGAGTGGCAGGCAGCAGGGGCTGGGTGAGGGCCGCCCAAGGCCAGGGTAGGCTGGGGGGCCGTTAAGATGTGGAGCTCTGCCCGTCCGAGGGGG
GCTCCGTGGAGGCAGACGAAGTGTGTGCCCCGCTGGGGCGAGTATGGGCAGGCTTGCGGCCACGTGGTGAAGGATGAACATTCGGGGTGCCCCGGACCTCGGGCAGCCCAGTGACGACCCCAACAGTG
GTGGAGAAAGAGAGCGGATTCGACAGCGCATGAAGATGGTCATCGGGCAACTTGAAGGCATCCTGAGGGAACTCAAAGAAGTGGCTAAGGAGCTGAGGGAGGTGGTGAGTCAGATCGACAAGCTAACC
TCTGACTTTGACTTTGAACTGGAGCCAGATGACTGGACCACGGCCACTGTGAGCAGCACCTCCAGCAGTGACAAGGCAGGTGCAGGCGGTCCCTTTGACCTGGGCCACCTGGACTTCATGACGGCTGA
TATCCTCTCAGACAGCTGGGAGTTCTGTTCCTTCCTGGATGTCTCTACCCCATCAGACTCGGTGGATGGTCCTGAGGCACCACGGCCAGGCACAGGCCCTGACTACCAGCTCATGAATGGTGGTTTGC
CCATCCCCAATGGGCCACGAGTGGAGACACCAGACTCCTCCAGTGAAGAGGCCTTCAGTGCTGGCCCTGCAAAGGGCCAGGTGCCCCAGCGGACTCCAGGGACAAGGGAGAGGGTACGGTTCAGTGAC
AAAGTGCTCTACCACGCTCTGTGCTGTGACGATGAAGAGGGGGATGGTGAGGAGGTAGAGGAGGAAGAGGCGGGCCTGGCCCCAGAGCTGCCCCGTGTGGAGCCACACACAGGCCCCCTCAAGCCCTC
CCCAGCCCCCTACAAGACCAAACGCTCTCCGTTGACCACCCGACGCTTGGGCCCCACGTTGGCCCCAGAACAGACCCGGAGGGTCACAAGGAACAGCAGCACTCAGACAGTATCAGACAAGAGCACGC
AGACAGTGCTGCCCTACACAGCCACCAAACAGAAAGCTAAGGGCAAGAACTAGGGGCTTGGGGGGGTGGTGCGGGGGATGCATAGAGCTATAAATATATATATATATATTTAAACAAAAAAAAAAAAA
AAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001107263	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58645	(Get FASTA)	NCBI Sequence Viewer
	B0BN13	(Get FASTA)	NCBI Sequence Viewer
	EDL95680	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000090146.1

RefSeq Acc Id:

NP_001107263 ⟸ NM_001113791

- UniProtKB:

B0BN13 (UniProtKB/Swiss-Prot), A6J508 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNIRGAPDLGQPSDDPNSGGERERIRQRMKMVIGQLEGILRELKEVAKELREVVSQIDKLTSDFDFELEPDDWTTATVSSTSSSDKAGAGGPFDLGHLDFMTADILSDSWEFCSFLDVSTPSDSVDGP
EAPRPGTGPDYQLMNGGLPIPNGPRVETPDSSSEEAFSAGPAKGQVPQRTPGTRERVRFSDKVLYHALCCDDEEGDGEEVEEEEAGLAPELPRVEPHTGPLKPSPAPYKTKRSPLTTRRLGPTLAPEQ
TRRVTRNSSTQTVSDKSTQTVLPYTATKQKAKGKN

hide sequence

Ensembl Acc Id:

ENSRNOP00000031920 ⟸ ENSRNOT00000033397

Ensembl Acc Id:

ENSRNOP00000090146 ⟸ ENSRNOT00000116428

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BN13-F1-model_v2	AlphaFold	B0BN13	1-291	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-30258	BioCyc
Ensembl Genes	ENSRNOG00000026238	Ensembl
	ENSRNOG00000068374	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000116428.1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:8363324	IMAGE-MGC_LOAD
InterPro	Largen/INSYN1	UniProtKB/Swiss-Prot
KEGG Report	rno:501007	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187587	IMAGE-MGC_LOAD
NCBI Gene	501007	ENTREZGENE
PANTHER	INHIBITORY SYNAPTIC FACTOR 1	UniProtKB/Swiss-Prot
	PTHR15917	UniProtKB/Swiss-Prot
Pfam	DUF4589	UniProtKB/Swiss-Prot
PhenoGen	Insyn1	PhenoGen
RatGTEx	ENSRNOG00000026238	RatGTEx
	ENSRNOG00000068374	RatGTEx
UniProt	A6J508	ENTREZGENE, UniProtKB/TrEMBL
	B0BN13	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-09-05	Insyn1	inhibitory synaptic factor 1	RGD1562618	similar to RIKEN cDNA 6030419C18 gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1562618	similar to RIKEN cDNA 6030419C18 gene	RGD1562618_predicted	similar to RIKEN cDNA 6030419C18 gene (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1562618_predicted	similar to RIKEN cDNA 6030419C18 gene (predicted)	LOC501007	similar to RIKEN cDNA 6030419C18 gene	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC501007	similar to RIKEN cDNA 6030419C18 gene			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar