Advanced Search (OLGA)

Gene: Spatc1l (spermatogenesis and centriole associated 1-like) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Spatc1l

Name:

spermatogenesis and centriole associated 1-like

RGD ID:

1562578

Description:

Predicted to enable identical protein binding activity and protein kinase A regulatory subunit binding activity. Predicted to be involved in spermatogenesis. Predicted to act upstream of or within actin polymerization or depolymerization; positive regulation of cAMP-dependent protein kinase activity; and positive regulation of cAMP/PKA signal transduction. Predicted to be located in cytoplasm. Predicted to be active in centrosome and sperm head-tail coupling apparatus. Orthologous to human SPATC1L (spermatogenesis and centriole associated 1 like); INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC499418; LOC108348157; LOC499418; similar to Putative protein C21orf56 homolog; speriolin-like protein; uncharacterized protein LOC499418

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	12,073,542 - 12,082,866 (-)	NCBI		GRCr8
mRatBN7.2	20	12,074,040 - 12,083,873 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	12,074,047 - 12,083,301 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	12,770,347 - 12,779,565 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	12,131,269 - 12,140,487 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	12,603,047 - 12,612,265 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	12,825,789 - 12,835,007 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	13,164,628 - 13,173,774 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	20	12,825,775 - 12,835,044 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	15,318,495 - 15,327,599 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	20	14,983,177 - 14,990,480 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	12,488,956 - 12,498,060 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	13,572,304 - 13,581,438 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spatc1l	Rat	autistic disorder		ISO	SPATC1L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Spatc1l	Rat	Axenfeld-Rieger syndrome type 3		ISO	SPATC1L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Axenfeld-Rieger syndrome type 3	ClinVar	PMID:11170889 and PMID:21681106
Spatc1l	Rat	cataract 9 multiple types		ISO	SPATC1L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Cataract 9 multiple types	ClinVar	PMID:28492532
Spatc1l	Rat	developmental and epileptic encephalopathy 30		ISO	SPATC1L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 30	ClinVar	PMID:28492532 and PMID:8596935
Spatc1l	Rat	homocystinuria		ISO	SPATC1L (Homo sapiens)	8554872	ClinVar Annotator: match by term: HYPERHOMOCYSTEINEMIA more ...	ClinVar	PMID:10338090 more ...
Spatc1l	Rat	primary ciliary dyskinesia		ISO	SPATC1L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary ciliary dyskinesia	ClinVar	PMID:28492532
Spatc1l	Rat	progressive myoclonus epilepsy		ISO	SPATC1L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Progressive myoclonic epilepsy	ClinVar	PMID:28492532 and PMID:8596935

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spatc1l	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Spatc1l (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SPATC1L mRNA	CTD	PMID:36331819
Spatc1l	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	Spatc1l (Mus musculus)	6480464	bisphenol S results in increased methylation of SPATC1L exon	CTD	PMID:33297965
Spatc1l	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Spatc1l (Mus musculus)	6480464	bisphenol S affects the methylation of SPATC1L gene	CTD	PMID:31683443
Spatc1l	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of SPATC1L mRNA	CTD	PMID:25825206
Spatc1l	Rat	aflatoxin B1	increases methylation	ISO	SPATC1L (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of SPATC1L gene	CTD	PMID:27153756
Spatc1l	Rat	benzo[a]pyrene	affects methylation	ISO	SPATC1L (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SPATC1L 5' UTR and Benzo(a)pyrene affects the methylation of SPATC1L promoter	CTD	PMID:27901495
Spatc1l	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SPATC1L mRNA	CTD	PMID:25181051 and PMID:34947998
Spatc1l	Rat	cadmium dichloride	decreases expression	ISO	SPATC1L (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of SPATC1L mRNA	CTD	PMID:38568856
Spatc1l	Rat	copper atom	multiple interactions	ISO	SPATC1L (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of SPATC1L mRNA	CTD	PMID:20971185
Spatc1l	Rat	copper(0)	multiple interactions	ISO	SPATC1L (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of SPATC1L mRNA	CTD	PMID:20971185
Spatc1l	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of SPATC1L mRNA	CTD	PMID:26577399
Spatc1l	Rat	diazinon	increases methylation	ISO	SPATC1L (Homo sapiens)	6480464	Diazinon results in increased methylation of SPATC1L gene	CTD	PMID:22964155
Spatc1l	Rat	Dibutyl phosphate	affects expression	ISO	SPATC1L (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of SPATC1L mRNA	CTD	PMID:37042841
Spatc1l	Rat	dichloroacetic acid	decreases expression	ISO	Spatc1l (Mus musculus)	6480464	Dichloroacetic Acid results in decreased expression of SPATC1L mRNA	CTD	PMID:28962523
Spatc1l	Rat	doxorubicin	decreases expression	ISO	SPATC1L (Homo sapiens)	6480464	Doxorubicin results in decreased expression of SPATC1L mRNA	CTD	PMID:29803840
Spatc1l	Rat	lead diacetate	multiple interactions	ISO	Spatc1l (Mus musculus)	6480464	[lead acetate results in increased abundance of Lead] which results in decreased expression of SPATC1L mRNA and [lead acetate results in increased abundance of Lead] which results in decreased expression of SPATC1L protein	CTD	PMID:32142724
Spatc1l	Rat	lead(0)	multiple interactions	ISO	Spatc1l (Mus musculus)	6480464	[lead acetate results in increased abundance of Lead] which results in decreased expression of SPATC1L mRNA and [lead acetate results in increased abundance of Lead] which results in decreased expression of SPATC1L protein	CTD	PMID:32142724
Spatc1l	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Spatc1l (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SPATC1L mRNA	CTD	PMID:36331819
Spatc1l	Rat	silicon dioxide	increases expression	ISO	SPATC1L (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of SPATC1L mRNA	CTD	PMID:25895662
Spatc1l	Rat	sodium arsenite	decreases expression	ISO	SPATC1L (Homo sapiens)	6480464	sodium arsenite results in decreased expression of SPATC1L mRNA	CTD	PMID:38568856
Spatc1l	Rat	sodium arsenite	decreases expression	ISO	Spatc1l (Mus musculus)	6480464	sodium arsenite results in decreased expression of SPATC1L mRNA	CTD	PMID:37682722
Spatc1l	Rat	thimerosal	decreases expression	ISO	SPATC1L (Homo sapiens)	6480464	Thimerosal results in decreased expression of SPATC1L mRNA	CTD	PMID:27188386
Spatc1l	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of SPATC1L mRNA	CTD	PMID:34492290
Spatc1l	Rat	thiram	decreases expression	ISO	SPATC1L (Homo sapiens)	6480464	Thiram results in decreased expression of SPATC1L mRNA	CTD	PMID:38568856
Spatc1l	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of SPATC1L mRNA	CTD	PMID:33387578
Spatc1l	Rat	Triptolide	increases expression	ISO	Spatc1l (Mus musculus)	6480464	triptolide results in increased expression of SPATC1L mRNA	CTD	PMID:32835833
Spatc1l	Rat	uranium atom	affects expression	ISO	SPATC1L (Homo sapiens)	6480464	Uranium affects the expression of SPATC1L mRNA	CTD	PMID:15672453
Spatc1l	Rat	valproic acid	increases expression	ISO	SPATC1L (Homo sapiens)	6480464	Valproic Acid results in increased expression of SPATC1L mRNA	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spatc1l	Rat	actin polymerization or depolymerization	acts_upstream_of_or_within	ISO	Spatc1l (Mus musculus)	1624291	MGI:6200789 PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	lipid biosynthetic process	involved_in	IEA	ARBA:ARBA00027236	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Spatc1l	Rat	positive regulation of cAMP-dependent protein kinase activity	acts_upstream_of_or_within	ISO	Spatc1l (Mus musculus)	1624291	PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	positive regulation of cAMP/PKA signal transduction	acts_upstream_of_or_within	ISO	Spatc1l (Mus musculus)	1624291	PR:Q9DBC7 PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	positive regulation of protein phosphorylation	acts_upstream_of_or_within	ISO	Spatc1l (Mus musculus)	1624291	PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	spermatogenesis	acts_upstream_of_or_within	ISO	Spatc1l (Mus musculus)	1624291	MGI:6200789 PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	spermatogenesis	involved_in	IBA	MGI:1923823 and PANTHER:PTN000499372	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Spatc1l	Rat	triterpenoid biosynthetic process	involved_in	IEA	InterPro:IPR018333	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spatc1l	Rat	centrosome	is_active_in	IBA	MGI:1921531 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Spatc1l	Rat	centrosome	located_in	ISO	Spatc1l (Mus musculus)	1624291	PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	cytoplasm	located_in	ISO	SPATC1L (Homo sapiens)	1624291	PMID:31429579	RGD	PMID:31429579
Spatc1l	Rat	lipid droplet	located_in	IEA	InterPro:IPR018333	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Spatc1l	Rat	sperm head-tail coupling apparatus	located_in	ISO	Spatc1l (Mus musculus)	1624291	PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	sperm head-tail coupling apparatus	is_active_in	IBA	MGI:1923823 and PANTHER:PTN000499372	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Spatc1l	Rat	identical protein binding	enables	ISO	SPATC1L (Homo sapiens) and UniProtKB:Q9H0A9-2	1624291	UniProtKB:Q9H0A9-2 and PMID:32296183	RGD	PMID:32296183
Spatc1l	Rat	intramolecular transferase activity	enables	IEA	InterPro:IPR002365 and InterPro:IPR018333	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Spatc1l	Rat	isomerase activity	enables	IEA	UniProtKB-KW:KW-0413	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Spatc1l	Rat	protein binding	enables	ISO	SPATC1L (Homo sapiens)	1624291	UniProtKB:A1L4K1 more ...	RGD	PMID:25416956
Spatc1l	Rat	protein binding	enables	ISO	Spatc1l (Mus musculus)	1624291	UniProtKB:E9Q774 and PMID:30026308	RGD	PMID:30026308
Spatc1l	Rat	protein binding	enables	ISO	SPATC1L (Homo sapiens) and UniProtKB:Q9H0A9-2	1624291	UniProtKB:A1L4K1 more ...	RGD	PMID:32296183
Spatc1l	Rat	protein kinase A regulatory subunit binding	enables	IBA	MGI:1923823 and PANTHER:PTN000499372	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Spatc1l	Rat	protein kinase A regulatory subunit binding	enables	ISO	Spatc1l (Mus musculus)	1624291	PR:Q9DBC7 PMID:30026308	RGD	PMID:30026308

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:30026308

Spatc1l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	12,073,542 - 12,082,866 (-)	NCBI		GRCr8
mRatBN7.2	20	12,074,040 - 12,083,873 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	12,074,047 - 12,083,301 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	12,770,347 - 12,779,565 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	12,131,269 - 12,140,487 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	12,603,047 - 12,612,265 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	12,825,789 - 12,835,007 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	13,164,628 - 13,173,774 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	20	12,825,775 - 12,835,044 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	15,318,495 - 15,327,599 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	20	14,983,177 - 14,990,480 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	12,488,956 - 12,498,060 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	13,572,304 - 13,581,438 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

SPATC1L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	46,161,160 - 46,184,459 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	46,161,148 - 46,184,476 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	47,581,074 - 47,604,373 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	46,405,498 - 46,428,729 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	46,405,497 - 46,428,729	NCBI
Celera	21	32,693,446 - 32,716,761 (-)	NCBI		Celera
Cytogenetic Map	21	q22.3	NCBI
HuRef	21	32,963,847 - 32,985,837 (-)	NCBI		HuRef
CHM1_1	21	47,141,961 - 47,163,904 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	21	44,540,975 - 44,566,185 (-)	NCBI		T2T-CHM13v2.0

Spatc1l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	76,394,180 - 76,406,035 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	76,398,106 - 76,406,035 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	76,561,993 - 76,570,201 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	76,562,272 - 76,570,201 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	76,025,017 - 76,032,945 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	76,005,988 - 76,013,916 (+)	NCBI		MGSCv36	mm8
Celera	10	77,606,787 - 77,614,715 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.2	NCBI

SPATC1L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	13	218,494,437 - 218,512,240 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103220344
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	89,781,950 - 89,805,927 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	89,782,182 - 89,803,593 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	18,164,576 - 18,188,041 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Spatc1l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	31,292,684 - 31,302,306 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	31,290,119 - 31,302,261 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Spatc1l
99 total Variants

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
631265	Iresp1	Immunoglobin response QTL1	8.3		blood anti-double stranded DNA antibody amount (VT:0004762)	serum anti-DNA antibody level (CMO:0001533)	20	9039719	13461775	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
12	12	61	61	53	29	12	29	12	98	48	37	9	52	24


RefSeq Transcripts	NM_001024296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC127868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079291	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001704 ⟹ ENSRNOP00000001704

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	13,164,628 - 13,173,774 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000074268 ⟹ ENSRNOP00000065946

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	12,825,775 - 12,835,044 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102485 ⟹ ENSRNOP00000077795

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	12,074,047 - 12,083,301 (-)	Ensembl

RefSeq Acc Id:

NM_001024296 ⟹ NP_001019467

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,073,542 - 12,082,760 (-)	NCBI
mRatBN7.2	20	12,074,040 - 12,083,261 (-)	NCBI
Rnor_6.0	20	12,825,789 - 12,835,007 (-)	NCBI
Rnor_5.0	20	15,318,495 - 15,327,599 (-)	NCBI
RGSC_v3.4	20	12,488,956 - 12,498,060 (-)	RGD
Celera	20	13,572,304 - 13,581,438 (-)	RGD

Sequence:

show sequence

CATGGGGCCACAGGCCCATATGTGAGCACTTGACACCATGGCAGAGGGGAGCGAGCTAATGAGCAGGCTCATGAGTGAGAACGCAGACCTGAAGAAGCAGGTGCGCCTCCTGAAGGAGAACCAGATGC
TGAAGAGACTGCTCAGCGAGAGTTGCCAGGACAGCTGTGGCCGAGGGAGCCGGGACCTGCTCTATCCCAAGGTCCCTACCTACCCTGAGGCCTGCTCCCCCGGGAATGGAGGTTCAGATTTTGGAAGG
TTTGCCAGCGTCCCTGACACAGCCTCCCAGCTACAGACATCCTCTCTGGAGGACCTGCTTTGCTCCCATGCTCCACTCTCCAGCGAGGACGACGCCTCCCCAGGCTGCGCGACCACCTCTCAGGTGCC
TTTCAAGACCTTCCTCAGCCCTCCCGAACTGCACGCACGGATTGCCGACAGGAAGCTGTCCTCACTCTTGAGTCCCTTGCAGGACTCCCTGGCTGACAAAACCCTGCTCGAGCCCAGGGAAATCTCGA
GACCTAAGAAGGTGTGCTTCTCGGAGAGTAACCTGCCCACTGGGGATAGGAGCAGGAGGACCTATTACCTCAATGAGATCCAGAGTTTTACGGGTGCCGAGAAGGATGGCCGCATCGTCGGGGAGATC
GCGTTCCAGCTTGACCGGCGTATCCTGGCCTATGTGTTCCCAGGGGTGACTCGCCTGTATGGTTTCACAGTGTCCAACATCCCTGAGAAAATCAAACAGACATCTATCAAGTCCCTAGATGGCTCCGT
GGATGAGAAGAAACTGCGCGAGCTGACACATCGCTATCTGACTCTGACGGCAAGGCTGGAGAAGCTGGGCTACAGCCGCGAAGTGCACCCAGTGTTCAGCGAGTTTCTCATCAACACCTACGGCATCC
TGAAGCAGCGTCCAGACTTGCGGGCCAACCCACTGCACAGCAGTCCGGCCGCCCTGCGCAAGCTTGTCATTGACATTGTGCCGCCCAAGTTCCTGGGTGACTCCCTGCTACTGCTGAATTGCCTGTGT
GAGCTCTCCAAGGAGGACAGCAAACCACTCTTCGCCTGGTGAGCCGCTCGCCTCACCCTTGCTGCAATAAACGTGTTTGTTCCAAACCCGGGGGCCCACCCGCGTCCTCCCGCATGGAAAGCTGTCTG
GCCCAGCAACAGTGGGGAGAGGCCACCTCCACGTCTGCGCTTGCCCAGGGCATCCAGCAGCTCGGGCCGTGCACAGCCACCGGGCACCTGTTGCCTTATTAAAAGCTTATTTATTTGTTTGCCTTAAA
AAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063279459 ⟹ XP_063135529

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	12,074,483 - 12,082,866 (-)	NCBI


Protein RefSeqs	NP_001019467	(Get FASTA)	NCBI Sequence Viewer
	XP_063135529	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79291	(Get FASTA)	NCBI Sequence Viewer
	EDL97140	(Get FASTA)	NCBI Sequence Viewer
	EDL97141	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070074.2
	ENSRNOP00000077795
	ENSRNOP00000077795.1
	ENSRNOP00000090987.1
	ENSRNOP00000093002.1

RefSeq Acc Id:

NP_001019467 ⟸ NM_001024296

- UniProtKB:

Q68FV7 (UniProtKB/TrEMBL), M0R8Y9 (UniProtKB/TrEMBL), A0A8I5Y6R1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEGSELMSRLMSENADLKKQVRLLKENQMLKRLLSESCQDSCGRGSRDLLYPKVPTYPEACSPGNGGSDFGRFASVPDTASQLQTSSLEDLLCSHAPLSSEDDASPGCATTSQVPFKTFLSPPELHA
RIADRKLSSLLSPLQDSLADKTLLEPREISRPKKVCFSESNLPTGDRSRRTYYLNEIQSFTGAEKDGRIVGEIAFQLDRRILAYVFPGVTRLYGFTVSNIPEKIKQTSIKSLDGSVDEKKLRELTHRY
LTLTARLEKLGYSREVHPVFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDIVPPKFLGDSLLLLNCLCELSKEDSKPLFAW

hide sequence

Ensembl Acc Id:

ENSRNOP00000065946 ⟸ ENSRNOT00000074268

Ensembl Acc Id:

ENSRNOP00000001704 ⟸ ENSRNOT00000001704

Ensembl Acc Id:

ENSRNOP00000077795 ⟸ ENSRNOT00000102485

RefSeq Acc Id:	XP_063135529 ⟸ XM_063279459
- Peptide Label:	isoform X1
- UniProtKB:	A6JKC5 (UniProtKB/TrEMBL)

Protein Domains

Speriolin C-terminal Speriolin N-terminal Squalene cyclase C-terminal Squalene cyclase N-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FV7-F1-model_v2	AlphaFold	Q68FV7	1-342	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701515

Promoter ID:

EPDNEW_R12039

Type:

multiple initiation site

Name:

Spatc1l_1

Description:

spermatogenesis and centriole associated 1-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	12,835,020 - 12,835,080	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-4192	BioCyc
Ensembl Genes	ENSRNOG00000001262	Ensembl
	ENSRNOG00000045929	Ensembl
	ENSRNOG00000054549	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000070409	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000081903.2	UniProtKB/TrEMBL
	ENSRNOT00000102485	ENTREZGENE
	ENSRNOT00000102485.1	UniProtKB/TrEMBL
	ENSRNOT00000107519.1	UniProtKB/TrEMBL
	ENSRNOT00000113267.1	UniProtKB/TrEMBL
Gene3D-CATH	1.50.10.20	UniProtKB/TrEMBL
	6.20.120.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7134390	IMAGE-MGC_LOAD
InterPro	SPATC1	UniProtKB/TrEMBL
	Speriolin_C	UniProtKB/TrEMBL
	Speriolin_N	UniProtKB/TrEMBL
	SQ_cyclase_C	UniProtKB/TrEMBL
	SQ_cyclase_N	UniProtKB/TrEMBL
	Squalene_cyclase	UniProtKB/TrEMBL
	Terpene_synthase_CS	UniProtKB/TrEMBL
	Terpenoid_cyclase/PrenylTrfase	UniProtKB/TrEMBL
KEGG Report	rno:499418	UniProtKB/TrEMBL
MGC_CLONE	MGC:94423	IMAGE-MGC_LOAD
NCBI Gene	499418	ENTREZGENE
PANTHER	LANOSTEROL SYNTHASE	UniProtKB/TrEMBL
	PTHR22192	UniProtKB/TrEMBL
	SPERIOLIN-LIKE PROTEIN	UniProtKB/TrEMBL
	TERPENE CYCLASE/MUTASE FAMILY MEMBER	UniProtKB/TrEMBL
Pfam	Speriolin_C	UniProtKB/TrEMBL
	Speriolin_N	UniProtKB/TrEMBL
	SQHop_cyclase_C	UniProtKB/TrEMBL
	SQHop_cyclase_N	UniProtKB/TrEMBL
PhenoGen	Spatc1l	PhenoGen
PROSITE	TERPENE_SYNTHASES	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001262	RatGTEx
	ENSRNOG00000045929	RatGTEx
	ENSRNOG00000054549	RatGTEx
	ENSRNOG00000070409	RatGTEx
Superfamily-SCOP	Terpenoid cyclases/Protein prenyltransferases	UniProtKB/TrEMBL
UniProt	A0A096MK55_RAT	UniProtKB/TrEMBL
	A0A8I5Y6R1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AEJ1_RAT	UniProtKB/TrEMBL
	A0A8I6AWE8_RAT	UniProtKB/TrEMBL
	A6JKC5	ENTREZGENE, UniProtKB/TrEMBL
	M0R8Y9	ENTREZGENE
	Q68FV7	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	M0R8Y9	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Spatc1l	spermatogenesis and centriole associated 1-like	LOC108348157	speriolin-like protein	Data merged from RGD:11505374	737654	PROVISIONAL
2016-08-02	LOC108348157	speriolin-like protein			Symbol and Name status set to provisional	70820	PROVISIONAL
2012-11-19	Spatc1l	spermatogenesis and centriole associated 1-like	LOC499418	similar to Putative protein C21orf56 homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC499418	similar to Putative protein C21orf56 homolog			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar