Tmem243 (transmembrane protein 243)

Advanced Search (OLGA)

Gene: Tmem243 (transmembrane protein 243) Rattus norvegicus

Analyze

Symbol:

Tmem243

Name:

transmembrane protein 243

RGD ID:

1562351

Description:

Orthologous to human TMEM243 (transmembrane protein 243); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC499990; LOC499990; RGD1562351; similar to chromosome 7 open reading frame 23; transmembrane protein 243, mitochondrial; uncharacterized protein LOC499990

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM243 (transmembrane protein 243)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Tmem243 (transmembrane protein 243, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem243 (transmembrane protein 243)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM243 (transmembrane protein 243)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM243 (transmembrane protein 243)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem243 (transmembrane protein 243)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM243 (transmembrane protein 243)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM243 (transmembrane protein 243)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem243 (transmembrane protein 243)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TMEM243 (transmembrane protein 243)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tmem243 (transmembrane protein 243, mitochondrial)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem243b (transmembrane protein 243, mitochondrial b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem243a (transmembrane protein 243, mitochondrial a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	tmem243	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	25,905,740 - 25,923,588 (-)	NCBI		GRCr8
mRatBN7.2	4	24,950,791 - 24,968,642 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	24,950,791 - 24,968,642 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	29,967,532 - 29,985,355 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	25,893,798 - 25,911,621 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	24,268,657 - 24,286,443 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	21,902,803 - 21,920,651 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	21,902,803 - 21,920,651 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	21,834,167 - 21,852,015 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	21,369,696 - 21,387,544 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	20,448,239 - 20,466,571 (-)	NCBI		Celera
Cytogenetic Map	4	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4,4'-sulfonyldiphenol (EXP)

acrylamide (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

hydrogen peroxide (ISO)

inulin (ISO)

methylmercury chloride (ISO)

nitrofen (EXP)

Nutlin-3 (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

theophylline (ISO)

trichloroethene (EXP)

triptonide (ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Tmem243
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	25,905,740 - 25,923,588 (-)	NCBI		GRCr8
mRatBN7.2	4	24,950,791 - 24,968,642 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	24,950,791 - 24,968,642 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	29,967,532 - 29,985,355 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	25,893,798 - 25,911,621 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	24,268,657 - 24,286,443 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	21,902,803 - 21,920,651 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	21,902,803 - 21,920,651 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	21,834,167 - 21,852,015 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	21,369,696 - 21,387,544 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	20,448,239 - 20,466,571 (-)	NCBI		Celera
Cytogenetic Map	4	q12	NCBI

TMEM243
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	87,196,160 - 87,220,587 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	87,196,160 - 87,220,587 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	86,825,476 - 86,849,903 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	86,663,414 - 86,686,967 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	86,470,130 - 86,493,682	NCBI
Celera	7	81,530,357 - 81,553,909 (-)	NCBI		Celera
Cytogenetic Map	7	q21.12	NCBI
HuRef	7	81,436,464 - 81,460,052 (-)	NCBI		HuRef
CHM1_1	7	86,755,502 - 86,778,704 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	88,446,097 - 88,470,238 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	86,156,988 - 86,180,540 (-)	NCBI

Tmem243
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	9,150,737 - 9,168,983 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	9,150,668 - 9,210,986 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	9,100,737 - 9,118,983 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	9,100,668 - 9,160,986 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	9,100,737 - 9,118,983 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	9,106,743 - 9,124,989 (+)	NCBI		MGSCv36	mm8
Celera	5	9,017,375 - 9,035,335 (+)	NCBI		Celera
Cytogenetic Map	5	A1	NCBI
cM Map	5	3.69	NCBI

Tmem243
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955621	42,121 - 50,628 (+)	NCBI	ChiLan1.0	ChiLan1.0

TMEM243
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	105,070,719 - 105,094,923 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	153,335,357 - 153,359,558 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	79,178,806 - 79,210,021 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	92,836,440 - 92,860,583 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	92,836,440 - 92,860,583 (-)	Ensembl	panpan1.1		panPan2

TMEM243
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	13,378,196 - 13,387,213 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	13,378,630 - 13,397,793 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	12,949,946 - 12,970,366 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	13,143,429 - 13,163,857 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	13,143,868 - 13,163,862 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	13,347,378 - 13,367,795 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	13,073,072 - 13,093,481 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	13,356,473 - 13,376,904 (-)	NCBI		UU_Cfam_GSD_1.0

Tmem243
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	26,405,870 - 26,427,032 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936763	1,574,312 - 1,595,523 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936763	1,574,372 - 1,664,339 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM243
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	93,393,722 - 93,416,627 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	93,393,695 - 93,416,634 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	102,873,776 - 102,896,734 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM243
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	61,722,078 - 61,744,605 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	61,722,206 - 61,744,126 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	42,312,874 - 42,335,462 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem243
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624739	34,631,269 - 34,652,654 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmem243
116 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	48
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000066211
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	31934116	Rat
724557	Plsm1	Polydactyly-luxate syndrome (PLS) morphotypes QTL 1		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	4	1	27716890	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	31934116	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	33250345	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	33250345	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	21333343	39505420	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	30372989	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
61408	Scl23	Serum cholesterol level QTL 23		0.0005	blood HDL phospholipid amount (VT:0010504)	serum high density lipoprotein phospholipid level (CMO:0001567)	4	1	27716890	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	22710685	34430484	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	31934116	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
61351	Bp33	Blood pressure QTL 33		0.0018	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	1	27716890	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	1	29494328	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
1358201	Gluco12	Glucose level QTL12	1.6		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake (CMO:0000870)	4	5218392	29593287	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	32584199	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	31934116	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21333343	44463908	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat

Markers in Region

RH139646

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	24,951,018 - 24,951,200 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	21,903,031 - 21,903,212	NCBI	Rnor6.0
Rnor_5.0	4	21,834,395 - 21,834,576	UniSTS	Rnor5.0
RGSC_v3.4	4	21,369,924 - 21,370,105	UniSTS	RGSC3.4
Celera	4	20,448,467 - 20,448,648	UniSTS
RH 3.4 Map	4	142.2	UniSTS
RH 3.4 Map	4	144.6	UniSTS
Cytogenetic Map	4	q12	UniSTS
Cytogenetic Map	4	q12-q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286465	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC162037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000066211 ⟹ ENSRNOP00000060280

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	24,950,791 - 24,968,642 (-)	Ensembl
Rnor_6.0 Ensembl	4	21,902,803 - 21,920,651 (-)	Ensembl

RefSeq Acc Id:

NM_001109219 ⟹ NP_001102689

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	25,905,740 - 25,923,588 (-)	NCBI
mRatBN7.2	4	24,950,791 - 24,968,642 (-)	NCBI
Rnor_6.0	4	21,902,803 - 21,920,651 (-)	NCBI
Rnor_5.0	4	21,834,167 - 21,852,015 (-)	NCBI
RGSC_v3.4	4	21,369,696 - 21,387,544 (-)	RGD
Celera	4	20,448,239 - 20,466,571 (-)	RGD

Sequence:

show sequence

GTGGGATTGGCTGCCTGAGTAGTGACGCGGTCTGGGCGGGCCCGACCAGTTTGCGACAGTGGCC
GCGGGTCCCGGACCGGAGAGCCTAGGGGACTCGCCGCACCGCGCCGGGGTCCCGCTGGCGTCTG
GGGGCCACGGCTCGGGGTCGCGGCGGGTGCGGGCGCTGCCAGGATCCGCCGCGCGCGCGGCGCG
GGACGCCGAGGGCCCGGGCCATGCGTGCGCCGTGAGGGGCGGGCGTCCGGACTTCGCGAGCTGA
TGCGGACTCGCTTTTGAGCGGCTGGGGACGAGCGAAGCAACCCCAAAATGGAGGACTTTGCTAC
CAGGACCTATGGGACCAGCGGCCTGGATAACAGACCTCTGTTTGGGGAGACGTCTGCCAAGGAC
CGAATCATCAATTTAGTAGTTGGCGGCTTAACCACCTTGTTGATCCTAGTAACACTGGTCAGTG
CTTTTCTGTTCCCTCAACTACCTCCCAAACCACTGAATATTTTTTTTGCTGTCTGCATCTCTTT
GAGTAGTATTACTGCCTGCATACTTATCTACTGGTATCGACAAGGAGACTTAGAACCGAAATTT
AGGAATCTCATTTACTATATCTTGTTTTCTATCATCATGCTGTGTATATGTGCGAACTTGTATT
TCCACGATGTGGGAAGGTGAGGCTGCAGACACGGGCTTACCAGGACGCTGGGAAATCTGTGTGA
ATGTCACTGCTGCAAACCAGTGTACGAAGAATGCTCCACACACGTCTGCTACATGATTTTCATG
TTAACTGTGAATCTGAATCCCCTCTTGCAAGGGAGCTGTACCATACATCTCTGCTTTCCTTTAA
AAAGCTGAAACATTCCAGCCCTTAAATAGCAAAGGATTTTCAGTTTTGAAATTTTTTTTTAACA
ATTTAATTGCATGGCTCAAAATCTTGCATTTTAAGACAAATACTCTTTTATTTCTGTTAAACTG
AATATACAATTATTGTTCCCTAGGCAACCAACTTTTCCTTACTACTACAGTTTCACATTAATAA
AACAGATGGTGAAAAGACAACTTTGATTGTGAAGATCTAATTACAGTAATAAATAAAATAATTT
ATACAAGT

hide sequence

RefSeq Acc Id:

XM_063286465 ⟹ XP_063142535

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	25,905,792 - 25,923,527 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102689	(Get FASTA)	NCBI Sequence Viewer
	XP_063142535	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62037	(Get FASTA)	NCBI Sequence Viewer
	EDL84310	(Get FASTA)	NCBI Sequence Viewer
	EDL84311	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060280.1

RefSeq Acc Id:	NP_001102689 ⟸ NM_001109219
- UniProtKB:	G3V9U5 (UniProtKB/TrEMBL), A6K229 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGGLTTLLILVTLVSAFLFPQLPPKPLNIFF AVCISLSSITACILIYWYRQGDLEPKFRNLIYYILFSIIMLCICANLYFHDVGR hide sequence

Ensembl Acc Id:

ENSRNOP00000060280 ⟸ ENSRNOT00000066211

RefSeq Acc Id:	XP_063142535 ⟸ XM_063286465
- Peptide Label:	isoform X1
- UniProtKB:	A6K229 (UniProtKB/TrEMBL), G3V9U5 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V9U5-F1-model_v2	AlphaFold	G3V9U5	1-118	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692825

Promoter ID:

EPDNEW_R3350

Type:

initiation region

Name:

Tmem243_1

Description:

transmembrane protein 243

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	21,920,604 - 21,920,664	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562351	AgrOrtholog
BioCyc Gene	G2FUF-45840	BioCyc
Ensembl Genes	ENSRNOG00000042758	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000066211.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7099001	IMAGE-MGC_LOAD
InterPro	DUF2678	UniProtKB/TrEMBL
KEGG Report	rno:499990	UniProtKB/TrEMBL
MGC_CLONE	MGC:187961	IMAGE-MGC_LOAD
NCBI Gene	499990	ENTREZGENE
PANTHER	PTHR28603	UniProtKB/TrEMBL
	TRANSMEMBRANE PROTEIN 243	UniProtKB/TrEMBL
Pfam	DUF2678	UniProtKB/TrEMBL
PhenoGen	Tmem243	PhenoGen
RatGTEx	ENSRNOG00000042758	RatGTEx
UniProt	A6K229	ENTREZGENE, UniProtKB/TrEMBL
	G3V9U5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-02	Tmem243	transmembrane protein 243	Tmem243	transmembrane protein 243, mitochondrial	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-12-18	Tmem243	transmembrane protein 243, mitochondrial	RGD1562351	similar to chromosome 7 open reading frame 23	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1562351	similar to chromosome 7 open reading frame 23	RGD1562351_predicted	similar to chromosome 7 open reading frame 23 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1562351_predicted	similar to chromosome 7 open reading frame 23 (predicted)	LOC499990	similar to chromosome 7 open reading frame 23	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499990	similar to chromosome 7 open reading frame 23			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar