Advanced Search (OLGA)

Gene: Ap4e1 (adaptor related protein complex 4 subunit epsilon 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ap4e1

Name:

adaptor related protein complex 4 subunit epsilon 1

RGD ID:

1562199

Description:

Predicted to enable cargo adaptor activity. Predicted to be involved in intracellular protein transport and vesicle-mediated transport. Predicted to be located in Golgi apparatus. Predicted to be part of AP-4 adaptor complex. Human ortholog(s) of this gene implicated in hereditary spastic paraplegia 51 and stuttering. Orthologous to human AP4E1 (adaptor related protein complex 4 subunit epsilon 1); INTERACTS WITH 3-chloropropane-1,2-diol; bisphenol A; gentamycin.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adaptor-related protein complex 4, epsilon 1 subunit; adaptor-related protein complex AP-4, epsilon 1; AP-4 complex subunit epsilon-1; LOC311404; RGD1562199; similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4); similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (AP-4 adapter complex epsilon subunit)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	134,726,338 - 134,792,820 (+)	NCBI		GRCr8
mRatBN7.2	3	114,272,997 - 114,339,484 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	114,272,956 - 114,336,752 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,164,967 - 118,228,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	126,760,516 - 126,824,351 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	124,420,900 - 124,484,727 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	119,484,714 - 119,548,491 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	119,484,677 - 119,548,621 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	126,010,551 - 126,074,949 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,550,205 - 114,615,150 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	113,113,130 - 113,177,269 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ap4e1	Rat	Bloom syndrome		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Ap4e1	Rat	colorectal cancer		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Ap4e1	Rat	congenital disorder of glycosylation Ig		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: ALG12-congenital disorder of glycosylation	ClinVar	PMID:23472171 more ...
Ap4e1	Rat	Developmental Disease		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental disorder	ClinVar	PMID:25741868
Ap4e1	Rat	Familial Persistent Stuttering 1		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:18414213 more ...
Ap4e1	Rat	genetic disease		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:18414213 more ...
Ap4e1	Rat	hereditary spastic paraplegia		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia	ClinVar	PMID:18414213 more ...
Ap4e1	Rat	hereditary spastic paraplegia		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia	ClinVar	PMID:18414213 more ...
Ap4e1	Rat	hereditary spastic paraplegia 51		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 51	ClinVar	PMID:18414213 more ...
Ap4e1	Rat	Nervous System Malformations		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Abnormality of the nervous system	ClinVar	PMID:25741868
Ap4e1	Rat	neuropathy		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Peripheral neuropathy	ClinVar
Ap4e1	Rat	paraplegia		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spastic paraplegia	ClinVar	PMID:16199547 more ...
Ap4e1	Rat	peripheral nervous system disease		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Peripheral neuropathy	ClinVar
Ap4e1	Rat	stuttering		ISO	AP4E1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: STAMMERING	ClinVar	PMID:18414213 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ap4e1	Rat	intellectual disability		ISO	AP4E1 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21937992

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ap4e1	Rat	Familial Persistent Stuttering 1		ISO	AP4E1 (Homo sapiens)	7240710		OMIM
Ap4e1	Rat	hereditary spastic paraplegia 51		ISO	AP4E1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ap4e1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Ap4e1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of AP4E1 mRNA	CTD	PMID:22206623
Ap4e1	Rat	17beta-estradiol	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	Estradiol results in increased expression of AP4E1 mRNA	CTD	PMID:31614463
Ap4e1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Ap4e1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Ap4e1	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Ap4e1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Ap4e1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Ap4e1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of AP4E1 mRNA	CTD	PMID:17949056 and PMID:21354282
Ap4e1	Rat	2-hydroxypropanoic acid	decreases expression	ISO	AP4E1 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of AP4E1 mRNA	CTD	PMID:30851411
Ap4e1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of AP4E1 protein	CTD	PMID:34915118
Ap4e1	Rat	4,4'-diaminodiphenylmethane	affects expression	ISO	Ap4e1 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane affects the expression of AP4E1 mRNA	CTD	PMID:18648102
Ap4e1	Rat	acrylamide	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	Acrylamide results in increased expression of AP4E1 mRNA	CTD	PMID:32763439
Ap4e1	Rat	aflatoxin B1	increases expression	ISO	Ap4e1 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of AP4E1 mRNA	CTD	PMID:19770486
Ap4e1	Rat	aflatoxin B1	increases methylation	ISO	AP4E1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of AP4E1 gene	CTD	PMID:27153756
Ap4e1	Rat	aristolochic acid A	decreases expression	ISO	AP4E1 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of AP4E1 mRNA	CTD	PMID:33212167
Ap4e1	Rat	arsane	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AP4E1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of AP4E1 mRNA	CTD	PMID:39836092
Ap4e1	Rat	arsenic atom	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AP4E1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of AP4E1 mRNA	CTD	PMID:39836092
Ap4e1	Rat	arsenite(3-)	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	arsenite inhibits the reaction [G3BP1 protein binds to AP4E1 mRNA]	CTD	PMID:32406909
Ap4e1	Rat	atrazine	decreases expression	ISO	AP4E1 (Homo sapiens)	6480464	Atrazine results in decreased expression of AP4E1 mRNA	CTD	PMID:22378314
Ap4e1	Rat	benzo[a]pyrene	increases mutagenesis	ISO	AP4E1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of AP4E1 gene	CTD	PMID:25435355
Ap4e1	Rat	beta-lapachone	decreases expression	ISO	AP4E1 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of AP4E1 mRNA	CTD	PMID:38218311
Ap4e1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of AP4E1 mRNA	CTD	PMID:25181051 and PMID:34947998
Ap4e1	Rat	bisphenol A	increases expression	ISO	Ap4e1 (Mus musculus)	6480464	bisphenol A results in increased expression of AP4E1 mRNA	CTD	PMID:35598803
Ap4e1	Rat	bisphenol A	decreases methylation	ISO	AP4E1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of AP4E1 gene	CTD	PMID:31601247
Ap4e1	Rat	bisphenol A	increases methylation	ISO	Ap4e1 (Mus musculus)	6480464	bisphenol A results in increased methylation of AP4E1 promoter	CTD	PMID:27312807
Ap4e1	Rat	cadmium dichloride	decreases expression	ISO	AP4E1 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of AP4E1 mRNA	CTD	PMID:38568856
Ap4e1	Rat	caffeine	decreases phosphorylation	ISO	AP4E1 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of AP4E1 protein	CTD	PMID:35688186
Ap4e1	Rat	cannabidiol	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	Cannabidiol results in increased expression of AP4E1 mRNA	CTD	PMID:27918106
Ap4e1	Rat	chlorpyrifos	decreases expression	ISO	Ap4e1 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of AP4E1 mRNA	CTD	PMID:37019170
Ap4e1	Rat	choline	multiple interactions	ISO	Ap4e1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of AP4E1 gene	CTD	PMID:20938992
Ap4e1	Rat	coumarin	increases phosphorylation	ISO	AP4E1 (Homo sapiens)	6480464	coumarin results in increased phosphorylation of AP4E1 protein	CTD	PMID:35688186
Ap4e1	Rat	cyclosporin A	increases methylation	ISO	AP4E1 (Homo sapiens)	6480464	Cyclosporine results in increased methylation of AP4E1 promoter	CTD	PMID:27989131
Ap4e1	Rat	doxorubicin	affects response to substance	ISO	AP4E1 (Homo sapiens)	6480464	AP4E1 mRNA affects the susceptibility to Doxorubicin	CTD	PMID:16044152
Ap4e1	Rat	folic acid	multiple interactions	ISO	Ap4e1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of AP4E1 gene	CTD	PMID:20938992
Ap4e1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of AP4E1 mRNA	CTD	PMID:33387578
Ap4e1	Rat	glyphosate	increases methylation	EXP		6480464	Glyphosate results in increased methylation of AP4E1 gene	CTD	PMID:31011160
Ap4e1	Rat	hydrogen peroxide	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	Hydrogen Peroxide results in increased expression of AP4E1 mRNA	CTD	PMID:18951874
Ap4e1	Rat	L-methionine	multiple interactions	ISO	Ap4e1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of AP4E1 gene	CTD	PMID:20938992
Ap4e1	Rat	lead(0)	affects expression	ISO	AP4E1 (Homo sapiens)	6480464	Lead affects the expression of AP4E1 mRNA	CTD	PMID:28903495
Ap4e1	Rat	manganese atom	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AP4E1 mRNA	CTD	PMID:39836092
Ap4e1	Rat	manganese(0)	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AP4E1 mRNA	CTD	PMID:39836092
Ap4e1	Rat	manganese(II) chloride	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AP4E1 mRNA	CTD	PMID:39836092
Ap4e1	Rat	methyl methanesulfonate	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of AP4E1 mRNA	CTD	PMID:23649840
Ap4e1	Rat	paracetamol	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of AP4E1 mRNA	CTD	PMID:26690555
Ap4e1	Rat	PCB138	multiple interactions	ISO	Ap4e1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Ap4e1	Rat	rac-lactic acid	decreases expression	ISO	AP4E1 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of AP4E1 mRNA	CTD	PMID:30851411
Ap4e1	Rat	resveratrol	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of AP4E1 mRNA	CTD	PMID:23557933
Ap4e1	Rat	sodium arsenate	increases expression	ISO	Ap4e1 (Mus musculus)	6480464	sodium arsenate results in increased expression of AP4E1 mRNA	CTD	PMID:21795629
Ap4e1	Rat	sodium arsenite	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of AP4E1 mRNA	CTD	PMID:38568856
Ap4e1	Rat	sodium arsenite	multiple interactions	ISO	AP4E1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of AP4E1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of AP4E1 mRNA	CTD	PMID:39836092
Ap4e1	Rat	sodium fluoride	increases expression	ISO	Ap4e1 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of AP4E1 mRNA	CTD	PMID:27862939
Ap4e1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of AP4E1 mRNA	CTD	PMID:23411599 and PMID:34492290
Ap4e1	Rat	titanium dioxide	decreases methylation	ISO	Ap4e1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of AP4E1 gene	CTD	PMID:35295148
Ap4e1	Rat	triphenyl phosphate	affects expression	ISO	AP4E1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of AP4E1 mRNA	CTD	PMID:37042841
Ap4e1	Rat	valproic acid	affects expression	ISO	Ap4e1 (Mus musculus)	6480464	Valproic Acid affects the expression of AP4E1 mRNA	CTD	PMID:17963808
Ap4e1	Rat	valproic acid	affects expression	ISO	AP4E1 (Homo sapiens)	6480464	Valproic Acid affects the expression of AP4E1 mRNA	CTD	PMID:25979313
Ap4e1	Rat	valproic acid	increases expression	ISO	AP4E1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of AP4E1 mRNA	CTD	PMID:23179753
Ap4e1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of AP4E1 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ap4e1	Rat	intracellular protein transport	involved_in	IEA	UniRule:UR000639756	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ap4e1	Rat	intracellular protein transport	involved_in	IEA	InterPro:IPR002553	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ap4e1	Rat	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ap4e1	Rat	protein transport	involved_in	IEA	InterPro:IPR017109	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ap4e1	Rat	vesicle-mediated transport	involved_in	IEA	UniRule:UR000639756	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ap4e1	Rat	vesicle-mediated transport	involved_in	IEA	InterPro:IPR002553	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ap4e1	Rat	AP-4 adaptor complex	part_of	ISO	AP4E1 (Homo sapiens)	1624291	PMID:10066790	RGD	PMID:10066790
Ap4e1	Rat	AP-4 adaptor complex	part_of	IEA	InterPro:IPR017109	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ap4e1	Rat	AP-4 adaptor complex	part_of	IBA	PANTHER:PTN000512984 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ap4e1	Rat	AP-4 adaptor complex	part_of	IEA	UniRule:UR000639756	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Ap4e1	Rat	cytoplasm	located_in	IEA	ARBA:ARBA00026971	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Ap4e1	Rat	endomembrane system	located_in	IEA	UniProtKB-SubCell:SL-0147	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ap4e1	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ap4e1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ap4e1	Rat	membrane coat	part_of	IEA	InterPro:IPR002553	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ap4e1	Rat	cargo adaptor activity	enables	IBA	FB:FBgn0264855 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ap4e1	Rat	protein binding	enables	ISO	AP4E1 (Homo sapiens)	1624291	UniProtKB:Q96N21 more ...	RGD	PMID:26496610 more ...
Ap4e1	Rat	protein binding	enables	ISO	Ap4e1 (Mus musculus)	1624291	UniProtKB:P23819 and PMID:18341993	RGD	PMID:18341993

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10066790

Ap4e1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	134,726,338 - 134,792,820 (+)	NCBI		GRCr8
mRatBN7.2	3	114,272,997 - 114,339,484 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	114,272,956 - 114,336,752 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,164,967 - 118,228,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	126,760,516 - 126,824,351 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	124,420,900 - 124,484,727 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	119,484,714 - 119,548,491 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	119,484,677 - 119,548,621 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	126,010,551 - 126,074,949 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,550,205 - 114,615,150 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	113,113,130 - 113,177,269 (+)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

AP4E1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	50,907,492 - 51,005,895 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	50,908,672 - 51,005,895 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	51,200,880 - 51,298,092 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	48,988,238 - 49,085,389 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	48,988,237 - 49,082,859	NCBI
Celera	15	28,093,991 - 28,191,516 (+)	NCBI		Celera
Cytogenetic Map	15	q21.2	NCBI
HuRef	15	28,030,752 - 28,128,080 (+)	NCBI		HuRef
CHM1_1	15	51,319,007 - 51,416,201 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	48,714,133 - 48,813,558 (+)	NCBI		T2T-CHM13v2.0

Ap4e1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	126,850,600 - 126,911,734 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	126,850,637 - 126,909,829 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	127,008,679 - 127,069,814 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	127,008,717 - 127,067,909 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	126,834,447 - 126,895,550 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	126,700,152 - 126,761,255 (+)	NCBI		MGSCv36	mm8
Celera	2	128,232,201 - 128,296,951 (+)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	61.76	NCBI

Ap4e1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955409	3,476,527 - 3,532,683 (-)	NCBI	ChiLan1.0	ChiLan1.0

AP4E1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	40,154,942 - 40,252,467 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	44,335,335 - 44,439,393 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	29,857,818 - 29,957,158 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	48,195,475 - 48,292,133 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	48,195,581 - 48,288,895 (+)	Ensembl	panpan1.1		panPan2

AP4E1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	16,745,567 - 16,800,662 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	16,745,620 - 16,797,704 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	16,671,629 - 16,726,720 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	16,890,099 - 16,945,193 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	16,879,004 - 16,945,179 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	16,812,394 - 16,867,478 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	16,929,887 - 16,984,952 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	17,036,542 - 17,091,637 (+)	NCBI		UU_Cfam_GSD_1.0

Ap4e1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	95,008,953 - 95,071,552 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	12,857,323 - 12,916,718 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	12,857,259 - 12,919,615 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AP4E1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	120,880,456 - 120,946,031 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	120,880,460 - 120,946,045 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	134,278,410 - 134,343,745 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AP4E1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	32,358,432 - 32,447,207 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	32,357,199 - 32,446,274 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	108,710,522 - 108,835,633 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ap4e1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	9,298,016 - 9,348,284 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	9,295,151 - 9,348,394 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ap4e1
466 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	6
Count of miRNA genes:	4
Interacting mature miRNAs:	6
Transcripts:	ENSRNOT00000037390
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

D3Mit12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	134,750,735 - 134,750,886 (+)	Marker Load Pipeline
mRatBN7.2	3	114,297,399 - 114,297,550 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,509,110 - 119,509,260	NCBI	Rnor6.0
Rnor_5.0	3	126,034,947 - 126,035,097	UniSTS	Rnor5.0
RGSC_v3.4	3	114,574,601 - 114,574,752	RGD	RGSC3.4
RGSC_v3.4	3	114,574,602 - 114,574,752	UniSTS	RGSC3.4
RGSC_v3.1	3	114,480,095 - 114,480,482	RGD
Celera	3	113,137,443 - 113,137,593	UniSTS
RH 2.0 Map	3	660.6	RGD
SHRSP x BN Map	3	54.0299	RGD
Cytogenetic Map	3	q36	UniSTS

RH132863

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	114,337,044 - 114,337,236 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,548,771 - 119,548,962	NCBI	Rnor6.0
Rnor_5.0	3	126,074,613 - 126,074,804	UniSTS	Rnor5.0
RGSC_v3.4	3	114,615,443 - 114,615,634	UniSTS	RGSC3.4
Celera	3	113,177,562 - 113,177,753	UniSTS
RH 3.4 Map	3	997.8	UniSTS
Cytogenetic Map	3	q36	UniSTS

BE101110

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	114,281,049 - 114,281,231 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,492,764 - 119,492,945	NCBI	Rnor6.0
Rnor_5.0	3	126,018,601 - 126,018,782	UniSTS	Rnor5.0
RGSC_v3.4	3	114,558,255 - 114,558,436	UniSTS	RGSC3.4
Celera	3	113,121,096 - 113,121,277	UniSTS
RH 3.4 Map	3	996.8	UniSTS
Cytogenetic Map	3	q36	UniSTS

RH141233

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	101,712,146 - 101,712,334 (+)	MAPPER	mRatBN7.2
mRatBN7.2	3	114,288,448 - 114,288,636 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,500,161 - 119,500,348	NCBI	Rnor6.0
Rnor_6.0	2	104,039,514 - 104,039,701	NCBI	Rnor6.0
Rnor_5.0	3	126,025,998 - 126,026,185	UniSTS	Rnor5.0
Rnor_5.0	2	123,761,527 - 123,761,714	UniSTS	Rnor5.0
RGSC_v3.4	3	114,565,653 - 114,565,840	UniSTS	RGSC3.4
RGSC_v3.4	2	104,333,613 - 104,333,800	UniSTS	RGSC3.4
Celera	2	97,106,105 - 97,106,292	UniSTS
Celera	3	113,128,494 - 113,128,681	UniSTS
Cytogenetic Map	3	q36	UniSTS
Cytogenetic Map	2	q24	UniSTS

AU049137

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	114,294,217 - 114,294,356 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	119,505,928 - 119,506,066	NCBI	Rnor6.0
Rnor_5.0	3	126,031,765 - 126,031,903	UniSTS	Rnor5.0
RGSC_v3.4	3	114,571,420 - 114,571,558	UniSTS	RGSC3.4
Celera	3	113,134,261 - 113,134,399	UniSTS
Cytogenetic Map	3	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001191742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234921	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037390 ⟹ ENSRNOP00000037349

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,272,956 - 114,336,752 (+)	Ensembl
Rnor_6.0 Ensembl	3	119,484,677 - 119,548,621 (+)	Ensembl

RefSeq Acc Id:

NM_001191742 ⟹ NP_001178671

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	134,726,338 - 134,790,088 (+)	NCBI
mRatBN7.2	3	114,272,997 - 114,336,752 (+)	NCBI
Rnor_6.0	3	119,484,714 - 119,548,478 (+)	NCBI
Rnor_5.0	3	126,010,551 - 126,074,949 (+)	NCBI
Celera	3	113,113,130 - 113,177,269 (+)	NCBI

Sequence:

show sequence

ATGAGCGACATGGTGGAGAGGACGCTGACCGCACTGCCGGGGCTCTTCTTGCAGAACCAGCTGGGAGGGCCTGCGGCCTCCAGAGCACCCTTCTTCTCCAGGCTGGGCGGCCTCATCCGTGGCGTCAC
TGCGCTCTCATCCAAGCACGAAGAAGAGAAGTTAATCCAGCAGGAACTGAGTAGTCTGAAGGCGACTGTTTCTGCTCCTACTACAACACTGAAAATGATGAAGGAATGTATGGTGAGACTTATATACT
GTGAGATGCTTGGATACGATGCTTCTTTTGGTTATATACATGCAATCAAGTTGGCCCAACAAGGAAACCTCTTAGAAAAAAGAGTGGGTTATTTGGCTGTTTCTCTGTTTCTACATGAAAGTCATGAA
CTTTTGCTTCTCCTTGTGAATACAGTGGTAAAGGACCTGCAGAGCACTAATCTGGTAGAAGTGTGTATGGCACTCACTGTCGTCAGCCAGATTTTCCCTCGAGAAATGATTCCAGCTGTCCTTCCACT
AATAGAAGAGAAACTCCAACATTCTAAGGAGATTATACGAAGAAAAGCAGTTCTGGCATTATACAAATTTTATCTCATTGCCCCTAATCAAGTACAGCATATCCATACTAAGTTTCGGAAAGCACTCT
GTGACAGAGATGTTGGGGTCATGGCTGCCTCTTTGCATATATACCTTAGGATGATTAAGGAAAATTCTTCTGGATATAAAGACTTGACTGAGAGTTTTGTAACAATTTTAAAGCAGGTGGTGGGGGGA
AAGCTCCCTGTAGAGTTCAGTTACCACAGTGTGCCAGCGCCATGGTTACAGATTCAGCTCTTGAGAATACTGGGACTGCTGGGAAAAGACGATGAAAGGACAAGTGAACTAATGTATGATGTTCTTGA
TGAATCCTTACGAAGAGCCGAGTTAAATCACAATGTCACTTACGCTATTCTGTTTGAGTGTGTACACACAATCTATTCTATTTATCCTAAATCAGAATTACTTGAGAAGGCTGCCAAGTGCATTGGAA
AATTTGTTCTGTCACCTAAAATAAACCTCAAATATTTAGGACTGAAGGCTCTTACCTATGTTATCCAGCAGGATCCTTCTCTGGCTCTTCAACACCAGATAACCATAATTGAATGCCTAGACCACCCT
GATCCCATTATTAAAAGAGAGACTCTGGAACTTCTTTACAGAATTACAAATGCACAGAATGTAGTAGTTATTGTACAGAAAATGCTTGAATATTTACATCAGAGCAAAGAAGAGTACATCATCATCAA
CTTAGTCGGCAAAATAGCTGAATTGGCTGAGAAATATGCTCCTGACAACGTGTGGTTCATTCAGACGATGAATGCTGTGTTTTCAGTGGGAGGAGATGTAATGCACCCAGACATTCTCAGTAACTTTC
TGAGACTGCTAGCAGAAGGTTTTGATGATGAAACAGAAGATCAACAGTTAAGACTCTATGCAGTTCAGTCTTACCTCACCTTACTAGACATGGAAAACACTTTCTATCCACAGAGATTTCTTCAAGTT
ATGAGTTGGGTATTAGGAGAGTATTCCTACCTCTTAGATAGAGAAAGCCCCGAGGCAGTTATGACCAGGCTCTACAAGTTACTGAGGAGTGACTCCATTTCTTCAGAAACGAAAGCATGGTTGTTTGC
TGCAGTAACCAAGTTAACACCTCAAGCTCATTCTTCTCCCATAGTTGAGAACTTAATCCAAGAATTCACTGTATCCTTGAATACTTGTCTGAGACAACATGCATTTGAATTGAAACATCTACATGAAA
ATGAAGAGCTTATGAAGAGCTTGCTTCAGAGTGCTCAGAATTGTGACGACATCATGGCAGATGCTTCTTTATCTTTTCTGGATGGTTTTGTGGCTGAAGGACTCAGTCAGGGAGCAGCACCTTATAAG
CCCCGTCACCAGCGCCAAGAGGAGCAGCTCTCTCAGGAAAAAGTTCTCAATTTTGAACCATATGGACTATCATTTTCTTCATCTGGCTTCACTGGACGACAGTCTCCTGCTGGCGTTTCTCTGGGCTC
AGATATATCTGGAAACAGTGCTGAAACAGGGCTGAAAGAGGCAGGTAGCCTGAAGATGGACGGCATAAAGAAATTATGGGGTAAAGAAGGTTATCTCCCCAAGAAGGAGAGTGGAGCTGCTGATAAAC
TGGAAGCCGCACATGCTCCTGCAGAGAGTGCAATGATGGAGAATGTAGACCAAGCCATGACTAGGAAGGACCAAGCTCAAGGCCACACCCCTTCTACAGAGGAGAAAGAAAAGCAGCTGTTGGCATCA
TCGCTGTTTGTTGGGCTAGGACCAGAAAATACGATCAATTTGTTGGGAAAAGCAGATGTTGTGTCTTACAAGTTCAGGAGGAAGTCAAAACCCAAGGTAGCCCAAAGTGACAAGATGCCCAGCGCTCA
TGCCGCTCCCTCCTCCACCCTTAGCCCTGTGTCCGATGTGGCTGGGGGGGATGAGGACAGTCTGAGCGCTGCGGATAGAGGAGACGGGGAGCTTGGTTCAGAGCTGTTGGGTTCTGAGTCTGTCTTGG
AGCTGCCCTCAGTTGAAAACCTCTCGAGTGTCAGCTTGCCCGTGTCTTCTTTGTTTGCGGGTAACGACATGGAAGTATTTCATCCCCCTTCATCCTCTGCAACTTCAGCCGTCAAGGAAGTCAGTTTG
GCTGCTCTGTTGGAAGAAACTCCTGAATGCAGGCGTTCAGCTCTCGTGGAAATCTGTAGTAATGAAACTGTGGCTGTGTCTTCTTACAAAGTCTGGAAGGATGAGTGTTTATTGCTGGTGTGCTCAGT
CACTAGTAAGACTGATTCAGAGTTCACAGATGCTCAATTAGAAATTTTTCCTTTGGAAAATTTCAAGATCATTGAGCAGCCTGGATGTCCTTCACCTGTGATGGAAGCAGAAAGCACCAAATCCTTCC
AATATGGCGTGCAGATGGAAAGCCCTTGTGTAGAGGGGACTCTCTCTGGTTTTATAAAGTATCAAATGATGGATACACATCCTGTTCAACTGGAATTTTCCATGAACTTATCACTACTAGATTTTATT
AGGCCATTAAAGATCTCAACTGAAGACTTTGGCAAACTCTGGTTGTCTTTTGCAAATGATGTGAAGCAAAATATAAAAATATCAGAGCCTCGAGTTGCACTGGCTTCTGTCCTGACAGAGCTGCAGCA
GAAACTCAGACTTTGCGTGGTTGACGTCATAGGCAGTGAAGGTCTGCTGGCCTGTAAGCTGCTTCCGTCCACCCCCTGTATCCTGCACTGCCGAGTACACGCTGACGTGGTAGCCCTGTGGTTCCGAT
CCTCTAGCTCTGTTCTTTCAGACTGTTTATCTTGTCACTGTCAGAAAGTGATGCAGACATCCTAGCAAAGTTCTGTTAAGTTTTACTTTTTTCACATAAATGGTTTACATTTACAACCTT

hide sequence

RefSeq Acc Id:

XM_039104990 ⟹ XP_038960918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	134,755,722 - 134,792,820 (+)	NCBI
mRatBN7.2	3	114,302,388 - 114,339,484 (+)	NCBI

RefSeq Acc Id:

XM_063283751 ⟹ XP_063139821

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	134,733,301 - 134,792,820 (+)	NCBI

RefSeq Acc Id:

XM_063283752 ⟹ XP_063139822

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	134,757,240 - 134,792,820 (+)	NCBI


Protein RefSeqs	NP_001178671	(Get FASTA)	NCBI Sequence Viewer
	XP_038960918	(Get FASTA)	NCBI Sequence Viewer
	XP_063139821	(Get FASTA)	NCBI Sequence Viewer
	XP_063139822	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL80098	(Get FASTA)	NCBI Sequence Viewer
	EDL80099	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000037349.5
	ENSRNOP00000112697

RefSeq Acc Id:

NP_001178671 ⟸ NM_001191742

- UniProtKB:

D3ZX21 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSDMVERTLTALPGLFLQNQLGGPAASRAPFFSRLGGLIRGVTALSSKHEEEKLIQQELSSLKATVSAPTTTLKMMKECMVRLIYCEMLGYDASFGYIHAIKLAQQGNLLEKRVGYLAVSLFLHESHE
LLLLLVNTVVKDLQSTNLVEVCMALTVVSQIFPREMIPAVLPLIEEKLQHSKEIIRRKAVLALYKFYLIAPNQVQHIHTKFRKALCDRDVGVMAASLHIYLRMIKENSSGYKDLTESFVTILKQVVGG
KLPVEFSYHSVPAPWLQIQLLRILGLLGKDDERTSELMYDVLDESLRRAELNHNVTYAILFECVHTIYSIYPKSELLEKAAKCIGKFVLSPKINLKYLGLKALTYVIQQDPSLALQHQITIIECLDHP
DPIIKRETLELLYRITNAQNVVVIVQKMLEYLHQSKEEYIIINLVGKIAELAEKYAPDNVWFIQTMNAVFSVGGDVMHPDILSNFLRLLAEGFDDETEDQQLRLYAVQSYLTLLDMENTFYPQRFLQV
MSWVLGEYSYLLDRESPEAVMTRLYKLLRSDSISSETKAWLFAAVTKLTPQAHSSPIVENLIQEFTVSLNTCLRQHAFELKHLHENEELMKSLLQSAQNCDDIMADASLSFLDGFVAEGLSQGAAPYK
PRHQRQEEQLSQEKVLNFEPYGLSFSSSGFTGRQSPAGVSLGSDISGNSAETGLKEAGSLKMDGIKKLWGKEGYLPKKESGAADKLEAAHAPAESAMMENVDQAMTRKDQAQGHTPSTEEKEKQLLAS
SLFVGLGPENTINLLGKADVVSYKFRRKSKPKVAQSDKMPSAHAAPSSTLSPVSDVAGGDEDSLSAADRGDGELGSELLGSESVLELPSVENLSSVSLPVSSLFAGNDMEVFHPPSSSATSAVKEVSL
AALLEETPECRRSALVEICSNETVAVSSYKVWKDECLLLVCSVTSKTDSEFTDAQLEIFPLENFKIIEQPGCPSPVMEAESTKSFQYGVQMESPCVEGTLSGFIKYQMMDTHPVQLEFSMNLSLLDFI
RPLKISTEDFGKLWLSFANDVKQNIKISEPRVALASVLTELQQKLRLCVVDVIGSEGLLACKLLPSTPCILHCRVHADVVALWFRSSSSVLSDCLSCHCQKVMQTS

hide sequence

Ensembl Acc Id:

ENSRNOP00000037349 ⟸ ENSRNOT00000037390

RefSeq Acc Id:	XP_038960918 ⟸ XM_039104990
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063139821 ⟸ XM_063283751
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063139822 ⟸ XM_063283752
- Peptide Label:	isoform X2

Protein Domains

AP-4 complex subunit epsilon-1 C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZX21-F1-model_v2	AlphaFold	D3ZX21	1-1130	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692394

Promoter ID:

EPDNEW_R2919

Type:

multiple initiation site

Name:

Ap4e1_1

Description:

adaptor-related protein complex 4, epsilon 1 subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	119,484,694 - 119,484,754	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-48013	BioCyc
Ensembl Genes	ENSRNOG00000022938	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000037390.7	UniProtKB/TrEMBL
	ENSRNOT00000164402	ENTREZGENE
Gene3D-CATH	1.25.10.10	UniProtKB/TrEMBL
InterPro	Adaptor_Complx_Large_Subunit	UniProtKB/TrEMBL
	AP4_complex_esu	UniProtKB/TrEMBL
	AP4E1_C	UniProtKB/TrEMBL
	ARM-like	UniProtKB/TrEMBL
	ARM-type_fold	UniProtKB/TrEMBL
	Clathrin/coatomer_adapt-like_N	UniProtKB/TrEMBL
KEGG Report	rno:311404	UniProtKB/TrEMBL
NCBI Gene	311404	ENTREZGENE
PANTHER	ADAPTIN, ALPHA/GAMMA/EPSILON	UniProtKB/TrEMBL
Pfam	Adaptin_N	UniProtKB/TrEMBL
	AP4E_app_platf	UniProtKB/TrEMBL
PhenoGen	Ap4e1	PhenoGen
PIRSF	AP4_complex_epsilon	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022938	RatGTEx
SMART	AP4E_app_platf	UniProtKB/TrEMBL
Superfamily-SCOP	ARM-type_fold	UniProtKB/TrEMBL
UniProt	D3ZX21	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-03	Ap4e1	adaptor related protein complex 4 subunit epsilon 1	Ap4e1	adaptor-related protein complex 4, epsilon 1 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Ap4e1	adaptor-related protein complex 4, epsilon 1 subunit	Ap4e1	adaptor-related protein complex AP-4, epsilon 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-29	Ap4e1	adaptor-related protein complex AP-4, epsilon 1	RGD1562199_predicted	similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-10	RGD1562199_predicted	similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (predicted)		similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (AP-4 adapter complex epsilon subunit) (predicted)	Name updated	1299863	APPROVED
2006-03-07	RGD1562199_predicted	similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (AP-4 adapter complex epsilon subunit) (predicted)	LOC311404	similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (AP-4 adapter complex epsilon subunit)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC311404	similar to Adapter-related protein complex 4 epsilon 1 subunit (Epsilon subunit of AP-4) (AP-4 adapter complex epsilon subunit)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM