Advanced Search (OLGA)

Gene: Sdhaf1 (succinate dehydrogenase complex assembly factor 1) Rattus norvegicus

Analyze

Symbol:

Sdhaf1

Name:

succinate dehydrogenase complex assembly factor 1

RGD ID:

1562079

Description:

Predicted to be involved in mitochondrial respiratory chain complex II assembly. Predicted to be located in mitochondrial matrix and nucleoplasm. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in mitochondrial complex II deficiency. Orthologous to human SDHAF1 (succinate dehydrogenase complex assembly factor 1); INTERACTS WITH atrazine; bisphenol A; fipronil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC108348111; LOC499125; LYR motif-containing protein 8; Lyrm8; RGD1562079; SDH assembly factor 1; succinate dehydrogenase assembly factor 1, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,703,662 - 94,704,611 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	94,702,409 - 94,706,092 (-)	Ensembl				GRCr8
mRatBN7.2	1	85,576,207 - 85,577,156 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,576,626 - 85,577,203 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	1	85,576,041 - 85,577,366 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	90,992,347 - 90,993,296 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,460,527 - 99,461,476 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,750,608 - 92,751,557 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,779,476 - 88,780,425 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	90,948,976 - 90,949,332 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,779,478 - 88,780,425 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	92,086,132 - 92,087,081 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,267,790 - 85,268,761 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	79,950,045 - 79,950,994 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

mitochondrial complex II deficiency (ISO)

Mitochondrial Complex II Deficiency Nuclear Type 1 (ISO)

Mitochondrial Complex II Deficiency Nuclear Type 2 (ISO)

vascular dementia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-colchicine (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

adenine (ISO)

aflatoxin B1 (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

fipronil (EXP)

folic acid (ISO)

formaldehyde (ISO)

indometacin (ISO)

leflunomide (ISO)

methapyrilene (ISO)

methyl methanesulfonate (ISO)

methylparaben (ISO)

mitomycin C (ISO)

ozone (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl isothiocyanate (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP)

thalidomide (ISO)

thiram (ISO)

trichloroethene (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial respiratory chain complex II assembly (IBA,IEA,ISO,ISS)

Cellular Component

mitochondrial matrix (IEA)

mitochondrion (IBA,IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:18614015	PMID:19465911

Genomics

Comparative Map Data

Sdhaf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,703,662 - 94,704,611 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	94,702,409 - 94,706,092 (-)	Ensembl				GRCr8
mRatBN7.2	1	85,576,207 - 85,577,156 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,576,626 - 85,577,203 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	1	85,576,041 - 85,577,366 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	90,992,347 - 90,993,296 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,460,527 - 99,461,476 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,750,608 - 92,751,557 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,779,476 - 88,780,425 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	90,948,976 - 90,949,332 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,779,478 - 88,780,425 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	92,086,132 - 92,087,081 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,267,790 - 85,268,761 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	79,950,045 - 79,950,994 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

SDHAF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,995,188 - 35,996,312 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,995,188 - 35,996,312 (+)	Ensembl			hg38	GRCh38
GRCh37	19	36,486,090 - 36,487,214 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	41,177,941 - 41,179,054 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	19	33,200,270 - 33,201,400 (+)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,991,372 - 32,992,502 (+)	NCBI		HuRef
CHM1_1	19	36,487,451 - 36,488,581 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	38,540,986 - 38,542,110 (+)	NCBI		T2T-CHM13v2.0

Sdhaf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,020,834 - 30,021,800 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,020,831 - 30,023,320 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	30,321,409 - 30,322,375 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,321,406 - 30,323,895 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	31,106,428 - 31,107,394 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,030,500 - 30,032,232 (+)	NCBI		MGSCv36	mm8
Celera	7	24,917,542 - 24,918,508 (-)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	17.39	NCBI

Sdhaf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	2,591,208 - 2,591,564 (-)	Ensembl
ChiLan1.0	NW_004955468	2,590,592 - 2,591,669 (-)	NCBI	ChiLan1.0	ChiLan1.0

SDHAF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,993,783 - 41,994,974 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,977,984 - 43,979,175 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,911,720 - 32,912,893 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,660,094 - 41,661,261 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,660,221 - 41,660,568 (+)	Ensembl			panPan2	panpan1.1

SDHAF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	116,688,153 - 116,689,278 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	116,688,808 - 116,689,164 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,093,882 - 116,094,987 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,291,305 - 117,292,410 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	117,289,181 - 117,292,423 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	116,855,323 - 116,856,465 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	116,478,868 - 116,479,973 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	117,534,093 - 117,535,198 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sdhaf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	11,262,525 - 11,263,666 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936922	32,759 - 33,115 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936922	32,655 - 33,795 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SDHAF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	45,375,288 - 45,377,965 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	45,374,714 - 45,376,346 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,777,318 - 40,779,024 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SDHAF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,906,458 - 30,907,934 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	30,906,916 - 30,907,263 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	8,701,200 - 8,702,359 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sdhaf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	10,261,555 - 10,261,911 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	10,261,448 - 10,263,410 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sdhaf1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	165,684,522 - 165,685,504 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sdhaf1
7 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	318
Count of miRNA genes:	193
Interacting mature miRNAs:	223
Transcripts:	ENSRNOT00000074494
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat

Markers in Region

RH129537

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	85,576,227 - 85,576,439 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	85,576,227 - 85,576,439 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	90,949,667 - 90,949,878	NCBI	Rnor6.0
Rnor_6.0	1	88,779,497 - 88,779,708	NCBI	Rnor6.0
Rnor_5.0	1	89,935,515 - 89,935,726	UniSTS	Rnor5.0
Rnor_5.0	1	92,086,849 - 92,087,060	UniSTS	Rnor5.0
RGSC_v3.4	1	85,267,814 - 85,268,025	UniSTS	RGSC3.4
Celera	1	79,950,066 - 79,950,277	UniSTS
RH 3.4 Map	1	850.2	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	12	61	134	57	60	41	86	41	298	168	11	125	71	76	19	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001177687	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC159436	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056877 ⟹ ENSRNOP00000053718

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	85,576,626 - 85,577,203 (+)	Ensembl
Rnor_6.0 Ensembl	1	90,948,976 - 90,949,332 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000074494 ⟹ ENSRNOP00000067764

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	94,702,409 - 94,706,092 (-)	Ensembl
mRatBN7.2 Ensembl	1	85,576,041 - 85,577,366 (-)	Ensembl
Rnor_6.0 Ensembl	1	88,779,478 - 88,780,425 (-)	Ensembl

RefSeq Acc Id:

NM_001177687 ⟹ NP_001171158

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,703,662 - 94,704,611 (-)	NCBI
mRatBN7.2	1	85,576,207 - 85,577,156 (-)	NCBI
Rnor_6.0	1	88,779,476 - 88,780,425 (-)	NCBI
Rnor_5.0	1	92,086,132 - 92,087,081 (+)	NCBI
Celera	1	79,950,045 - 79,950,994 (-)	NCBI

Sequence:

show sequence

GGGCGACTGACCGCGACGCAGCGGTCATGAGCCGGCTTAGCCGGCTGCAGAGGCAAGTTCTGAG
CCTGTACCGCGAACTGCTGCGCGCCGGGCGCGGGAAGCCGGGCGCCGAGGCACGGGTGCGGGCC
GAGTTCCGGCAGCACGCCAGCCTTCCGCGCTCCGACGTGCTGCGTATCGAGTATCTGTATCGCC
GGGGACGGCGCCAGCTACAGCTGCTGCGTTCCGGCCACGCCACGGCCATGGGTACTTTCGTGCG
CCCGCGGGGCCCTACTGAAGAACCCGTCGACGCGACAGCCCCGGGGAACAGGCTGGACGATAGT
GATGCCCTAAAGAATCCTTGTGAAGGCACGGGAGCACGGGAAACGCGATCCGATGGACGGTGAC
AGACCCAGAGAAAGGTTCCTTTTGACAGTTTGGGAGGAAGATCGGGAACTCATCCAAATGGAAG
CTGAGATGTCTTAAGAGACAACGGAATTTTCTCGATGCATGGTGAGAGGTCAGACACTCCCTCA
CCAAGGAGGTTCCGGGCATCCGGTGGCACCGGCTGGCTGAACAATGTATGCTGGGATTCACCAA
CCCAAAGTCAAAGAGAGCACAGACTCACGTTCTCCTCCCCTCGGGGCGTGACACCTCTCTTGAC
TTCTAAGAACACATACACCTCCCCACTCCCTGCCTTTTGCTGTTTTTAATGCCGAGAAAACGGC
CTTTTTGCCGTGCATGTTTAATGGAACACCCTGATGAACCATGAGAAGCTTCGCGGTCCGGTTT
GGAAAACCACTGCCCGACTTGTTGTGAAGAACCAGGATTGTAAGGGAGGTTACAGTAACTCACC
CCAGCTGATGAGCCTGAGACTTCTGGAGAATCCCTAGCCCCTATTCTTGTCAGTCTTCCTCAGG
ATTCTTGTATAAAGGGAATAAATGTGAGGTGTGCTTTCTTCCTTGTTGTCTTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001171158	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI59437	(Get FASTA)	NCBI Sequence Viewer
	B0K036	(Get FASTA)	NCBI Sequence Viewer
	EDM07770	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067764
	ENSRNOP00000067764.1

RefSeq Acc Id:	NP_001171158 ⟸ NM_001177687
- UniProtKB:	B0K036 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSRLSRLQRQVLSLYRELLRAGRGKPGAEARVRAEFRQHASLPRSDVLRIEYLYRRGRRQLQLL RSGHATAMGTFVRPRGPTEEPVDATAPGNRLDDSDALKNPCEGTGARETRSDGR hide sequence

Ensembl Acc Id:

ENSRNOP00000053718 ⟸ ENSRNOT00000056877

Ensembl Acc Id:

ENSRNOP00000067764 ⟸ ENSRNOT00000074494

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0K036-F1-model_v2	AlphaFold	B0K036	1-118	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689914

Promoter ID:

EPDNEW_R436

Type:

initiation region

Name:

Sdhaf1_1

Description:

succinate dehydrogenase complex assembly factor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	88,780,436 - 88,780,496	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562079	AgrOrtholog
BioCyc Gene	G2FUF-60123	BioCyc
Ensembl Genes	ENSRNOG00000037541	Ensembl
	ENSRNOG00000047045	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074494	ENTREZGENE
	ENSRNOT00000074494.2	UniProtKB/Swiss-Prot
InterPro	Complex1_LYR	UniProtKB/Swiss-Prot
	Complex1_LYR_SDHAF1_LYRM8	UniProtKB/Swiss-Prot
	SDHAF1	UniProtKB/Swiss-Prot
KEGG Report	rno:499125	UniProtKB/Swiss-Prot
NCBI Gene	499125	ENTREZGENE
PANTHER	SUCCINATE DEHYDROGENASE ASSEMBLY FACTOR 1, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	SUCCINATE DEHYDROGENASE ASSEMBLY FACTOR 1, MITOCHONDRIAL	UniProtKB/Swiss-Prot
Pfam	Complex1_LYR	UniProtKB/Swiss-Prot
PhenoGen	Sdhaf1	PhenoGen
RatGTEx	ENSRNOG00000037541	RatGTEx
	ENSRNOG00000047045	RatGTEx
UniProt	B0K036	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Sdhaf1	succinate dehydrogenase complex assembly factor 1	LOC108348111	succinate dehydrogenase assembly factor 1, mitochondrial	Data merged from RGD:11365590	737654	PROVISIONAL
2016-08-02	LOC108348111	succinate dehydrogenase assembly factor 1, mitochondrial			Symbol and Name status set to provisional	70820	PROVISIONAL
2010-05-05	Sdhaf1	succinate dehydrogenase complex assembly factor 1	RGD1562079	RGD1562079	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1562079	RGD1562079	RGD1562079_predicted	RGD1562079 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1562079_predicted	RGD1562079 (predicted)	LOC499125	LOC499125	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499125	LOC499125			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM