Advanced Search (OLGA)

Gene: Odam (odontogenic, ameloblast associated) Rattus norvegicus

Analyze

Symbol:

Odam

Name:

odontogenic, ameloblast associated

RGD ID:

1561883

Description:

Involved in odontogenesis. Predicted to be located in cell periphery; extracellular space; and supramolecular fiber. Predicted to be active in cytoplasm and nucleus. Orthologous to human ODAM (odontogenic, ameloblast associated); INTERACTS WITH bisphenol A; cadmium dichloride; tributylstannane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Apin; APIN precursor; odontogenic ameloblast-associated protein; odontogenic, ameloblast asssociated

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	20,472,530 - 20,496,752 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	20,472,546 - 20,481,760 (-)	Ensembl				GRCr8
mRatBN7.2	14	20,193,286 - 20,202,517 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	20,193,302 - 20,202,517 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	20,123,607 - 20,132,626 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	21,442,493 - 21,451,512 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	20,173,243 - 20,182,287 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	21,842,990 - 21,852,216 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	21,842,990 - 21,852,216 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	21,753,075 - 21,767,321 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	21,714,378 - 21,724,054 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	19,595,876 - 19,605,037 (-)	NCBI		Celera
Cytogenetic Map	14	p21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

doxorubicin (ISO)

malathion (ISO)

okadaic acid (ISO)

paracetamol (ISO)

quercetin (ISO)

S-nitrosoglutathione (ISO)

testosterone (ISO)

titanium dioxide (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biomineral tissue development (IEA)

inflammatory response (IEA,ISO)

odontogenesis (IEP)

odontogenesis of dentin-containing tooth (IBA,IEA,ISO)

positive regulation of epithelial cell proliferation involved in wound healing (IEA,ISO)

positive regulation of gene expression (IEA,ISO)

positive regulation of GTPase activity (ISO)

positive regulation of protein phosphorylation (ISO)

regulation of actin cytoskeleton organization (IEA,ISO)

response to wounding (IEA,ISO)

Cellular Component

cell periphery (IEA,ISO)

cytoplasm (IBA,IEA,ISO)

cytosol (IEA,ISO)

extracellular region (IEA,ISO)

extracellular space (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

supramolecular fiber (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Odontogenic Ameloblast-associated Protein (ODAM) Mediates Junctional Epithelium Attachment to Teeth via Integrin-ODAM-Rho Guanine Nucleotide Exchange Factor 5 (ARHGEF5)-RhoA Signaling.	Lee HK, etal., J Biol Chem. 2015 Jun 5;290(23):14740-53. doi: 10.1074/jbc.M115.648022. Epub 2015 Apr 24.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:14647039	PMID:15234340	PMID:16674676	PMID:17647262	PMID:21092812	PMID:21154245	PMID:22387195

Genomics

Comparative Map Data

Odam
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	20,472,530 - 20,496,752 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	20,472,546 - 20,481,760 (-)	Ensembl				GRCr8
mRatBN7.2	14	20,193,286 - 20,202,517 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	20,193,302 - 20,202,517 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	20,123,607 - 20,132,626 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	21,442,493 - 21,451,512 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	20,173,243 - 20,182,287 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	21,842,990 - 21,852,216 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	21,842,990 - 21,852,216 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	21,753,075 - 21,767,321 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	21,714,378 - 21,724,054 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	19,595,876 - 19,605,037 (-)	NCBI		Celera
Cytogenetic Map	14	p21	NCBI

ODAM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	70,195,725 - 70,204,576 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	70,195,706 - 70,205,734 (+)	Ensembl			hg38	GRCh38
GRCh37	4	71,061,442 - 71,070,293 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	71,096,833 - 71,104,882 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	4	68,420,214 - 68,428,263 (+)	NCBI		Celera
Cytogenetic Map	4	q13.3	NCBI
HuRef	4	66,864,474 - 66,872,522 (+)	NCBI		HuRef
CHM1_1	4	71,098,652 - 71,106,701 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	73,535,038 - 73,543,889 (+)	NCBI		T2T-CHM13v2.0

Odam
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	88,032,869 - 88,042,668 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	88,032,888 - 88,042,033 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	87,885,010 - 87,894,809 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	87,885,029 - 87,894,174 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	88,314,720 - 88,321,770 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	88,962,048 - 88,968,733 (+)	NCBI		MGSCv36	mm8
MGSCv36	5	87,491,886 - 87,498,571 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	5	E1	NCBI
cM Map	5	43.56	NCBI

Odam
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955447	2,653,815 - 2,661,043 (-)	Ensembl
ChiLan1.0	NW_004955447	2,653,815 - 2,661,043 (-)	NCBI	ChiLan1.0	ChiLan1.0

ODAM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	59,878,118 - 59,887,218 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	60,074,401 - 60,083,715 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	54,019,039 - 54,028,085 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	60,362,655 - 60,370,747 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	60,362,655 - 60,370,747 (-)	Ensembl			panPan2	panpan1.1

ODAM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	59,588,642 - 59,597,873 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	59,588,647 - 59,597,873 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	59,315,664 - 59,324,921 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	60,383,221 - 60,392,488 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	60,383,221 - 60,392,488 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	59,997,363 - 60,006,605 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	59,501,814 - 59,511,051 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	60,648,776 - 60,658,033 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Odam
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	15,986,195 - 15,993,294 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936598	4,438,258 - 4,445,316 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936598	4,438,258 - 4,445,316 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ODAM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	67,058,472 - 67,066,564 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	67,059,284 - 67,068,117 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	148,456,188 - 148,465,034 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ODAM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	18,676,794 - 18,687,325 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	18,678,422 - 18,685,932 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666084	4,236,479 - 4,251,148 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Odam
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624890	1,623,562 - 1,629,960 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624890	1,622,846 - 1,631,114 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Odam
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	1,078,909 - 1,088,205 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Odam
89 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	20
Count of miRNA genes:	20
Interacting mature miRNAs:	20
Transcripts:	ENSRNOT00000037003
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3957878	21572472	Rat
631528	Scl11	Serum cholesterol level QTL 11	4.9		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	14	17875645	36079022	Rat
7411573	Bw139	Body weight QTL 139	4.7	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	14	1	40068101	Rat
9589814	Gluco67	Glucose level QTL 67	4.54	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	40068101	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9393298	39411170	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11334906	30674469	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	28389666	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3957878	31121464	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8621398	53621398	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18915454	42433608	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3957878	24886169	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18895192	63895192	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17906726	54251504	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41415516	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1	31893212	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8621398	53621398	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	15137594	31238250	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
2	1	10	19	11	8	1	18	1	1	47	32	1	14	11	51	7	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001044274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063273575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ198380	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037003 ⟹ ENSRNOP00000035991

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	20,472,546 - 20,481,760 (-)	Ensembl
mRatBN7.2 Ensembl	14	20,193,302 - 20,202,517 (-)	Ensembl
Rnor_6.0 Ensembl	14	21,842,990 - 21,852,216 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103950 ⟹ ENSRNOP00000097228

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	20,473,941 - 20,481,760 (-)	Ensembl
mRatBN7.2 Ensembl	14	20,194,697 - 20,202,517 (-)	Ensembl

RefSeq Acc Id:

NM_001044274 ⟹ NP_001037739

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	20,472,530 - 20,481,760 (-)	NCBI
mRatBN7.2	14	20,193,286 - 20,202,517 (-)	NCBI
Rnor_6.0	14	21,842,990 - 21,852,216 (-)	NCBI
Rnor_5.0	14	21,753,075 - 21,767,321 (-)	NCBI
RGSC_v3.4	14	21,714,378 - 21,724,054 (-)	RGD
Celera	14	19,595,876 - 19,605,037 (-)	RGD

Sequence:

show sequence

TGAGAAAGAAAGGGACACAGATCTTACAAAGAAGTAAGGTATATCATCTGAAAATGAAAATTAT
AATTCTTCTTGGACTCATCGGAGCTACATCGTCAGCCCCGCTTATAACACAGCGTCTATTGTCT
GCTAGCAACAGCCATGAGTTACTCCTGAATCTTAATAATGGTCAACTTTTGCCACTGCAATTTC
AGAGCGCCTTCAACTCCTGGATTCCTCCCTTCCCTGGGCTTCTACAGCAGCAACAGCAGCAGGC
TCAGGTCTCAGGACACCCACAGTTTCCTCTCTCAACACTAGAGAGCTTTGCTGGGCTATTCCCA
AATCAGATACCTTTCTCAAGACAGGTTGGGTTTGCCCAAGGAGGTCAGGCTGGCCAGCCAGACT
TCTCACAGCAGCAGACACCATCTCAGACCCAGCAGGCTAGTCCTATGTCCTATGTGGTTCCTGT
AAAAGTGCCTCAAGATCAAACACAGATGTTTCAGTACTACCCAGTTTACATGCTTCTGCCCTGG
GAGCAACCACAGCAGACAGTCACATCCTCTCCCCAGCAGACAGGGCAGCAGCTATACGAGGAAC
AGATACCATTCTATAATCAATTTGGATTTGTACCACAACAAGCAGAACCTGGTGTACCAGGAGG
ACAGCAGCACTTAGTTCTTGACAGCTTTGTAGGCACAGCTCCAGAAACTCCTGGAATGCCAGCA
GTAGAAGGCCCGCTGTATCCACAAAAAGAACCAATCGGCTTTAAGCAAGATAATGTAGGCGTTT
CCACGCCCTCAACTTCACCAAAACCCGACACGGGCAATTTTTTCACTTCTGAAATAAACCCGAC
GATTGCTCCACTGCTTCCAGAACAGAAGGTCAATGCTGATAGCCTAAGAGAACCATAAGACTTT
GTTTACATCACTCAGAAGTTTTGGAAGAAGATGAGATGGTACCTTGGCGTCTTTTAAAGATTAT
TGTCTTCTTATATGCTAATAGAAGTTTGTTTAATGATATAAAGCCTCTTCACTGATCTCATTTT
TCTTTACTTAAAAAAGATATACTATTGATGTCACAAAAAATAATGTATCATGGAAAAATCCTAT
CTTTATAATGTTGTCATTTCCCCAAAGATTATGGGGTTATATAATCTGGAAAATGACAAGCACT
AAAAATAAAGCATATTTAACCAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063273575 ⟹ XP_063129645

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	20,472,530 - 20,496,752 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001037739	(Get FASTA)	NCBI Sequence Viewer
	XP_063129645	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABA54404	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035991
GenBank Protein	Q3HS83	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001037739 ⟸ NM_001044274
- Peptide Label:	precursor
- UniProtKB:	Q3HS83 (UniProtKB/Swiss-Prot), A0A8I6AW47 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKIIILLGLIGATSSAPLITQRLLSASNSHELLLNLNNGQLLPLQFQSAFNSWIPPFPGLLQQQ QQQAQVSGHPQFPLSTLESFAGLFPNQIPFSRQVGFAQGGQAGQPDFSQQQTPSQTQQASPMSY VVPVKVPQDQTQMFQYYPVYMLLPWEQPQQTVTSSPQQTGQQLYEEQIPFYNQFGFVPQQAEPG VPGGQQHLVLDSFVGTAPETPGMPAVEGPLYPQKEPIGFKQDNVGVSTPSTSPKPDTGNFFTSE INPTIAPLLPEQKVNADSLREP hide sequence

Ensembl Acc Id:

ENSRNOP00000035991 ⟸ ENSRNOT00000037003

Ensembl Acc Id:

ENSRNOP00000097228 ⟸ ENSRNOT00000103950

RefSeq Acc Id:	XP_063129645 ⟸ XM_063273575
- Peptide Label:	isoform X1
- UniProtKB:	F1LR01 (UniProtKB/TrEMBL), A0A8I6AW47 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3HS83-F1-model_v2	AlphaFold	Q3HS83	1-278	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561883	AgrOrtholog
BioCyc Gene	G2FUF-16139	BioCyc
Ensembl Genes	ENSRNOG00000023372	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000037003	ENTREZGENE
InterPro	Odam	UniProtKB/Swiss-Prot
KEGG Report	rno:641555	UniProtKB/Swiss-Prot
NCBI Gene	641555	ENTREZGENE
PANTHER	ODONTOGENIC AMELOBLAST-ASSOCIATED PROTEIN	UniProtKB/Swiss-Prot
	PTHR16237	UniProtKB/Swiss-Prot
Pfam	ODAM	UniProtKB/Swiss-Prot
PhenoGen	Odam	PhenoGen
RatGTEx	ENSRNOG00000023372	RatGTEx
UniProt	A0A8I6AW47	ENTREZGENE, UniProtKB/TrEMBL
	F1LR01	ENTREZGENE, UniProtKB/TrEMBL
	ODAM_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-16	Odam	odontogenic, ameloblast associated	Odam	odontogenic, ameloblast asssociated	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Odam	odontogenic, ameloblast asssociated	Apin	APIN precursor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Apin	APIN precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message