Symbol:
Bri3bp
Name:
Bri3 binding protein
RGD ID:
1561711
Description:
Predicted to be located in membrane. Predicted to be active in mitochondrion. Orthologous to human BRI3BP (BRI3 binding protein); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BRI3-binding protein; LOC498176; similar to BRI3-binding protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BRI3BP (BRI3 binding protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Bri3bp (Bri3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bri3bp (BRI3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BRI3BP (BRI3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BRI3BP (BRI3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bri3bp (BRI3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BRI3BP (BRI3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BRI3BP (BRI3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bri3bp (BRI3 binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
BRI3BP (BRI3 binding protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bri3bp (Bri3 binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bri3bp (bri3 binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bri3bp
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 36,838,098 - 36,849,919 (-) NCBI GRCr8 mRatBN7.2 12 31,176,742 - 31,188,563 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 31,173,971 - 31,188,572 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 32,347,442 - 32,359,299 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 32,958,867 - 32,970,726 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 32,010,791 - 32,022,648 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 36,576,018 - 36,587,839 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 36,576,020 - 36,587,839 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 38,445,350 - 38,457,171 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 32,270,907 - 32,282,728 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 32,871,267 - 32,883,085 (-) NCBI Celera Cytogenetic Map 12 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bri3bp Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BRI3BP mRNA] CTD PMID:31150632 Bri3bp Rat (1->4)-beta-D-glucan multiple interactions ISO Bri3bp (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BRI3BP mRNA CTD PMID:36331819 Bri3bp Rat 1,2-dimethylhydrazine increases expression ISO Bri3bp (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BRI3BP mRNA CTD PMID:22206623 Bri3bp Rat 17alpha-ethynylestradiol multiple interactions ISO Bri3bp (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BRI3BP mRNA CTD PMID:17942748 Bri3bp Rat 17beta-estradiol multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of BRI3BP mRNA CTD PMID:20404318 Bri3bp Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of BRI3BP mRNA CTD PMID:26496021 Bri3bp Rat 17beta-estradiol increases expression ISO BRI3BP (Homo sapiens) 6480464 Estradiol results in increased expression of BRI3BP mRNA CTD PMID:23019147 Bri3bp Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO BRI3BP (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Bri3bp Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bri3bp (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of BRI3BP mRNA CTD PMID:17942748 Bri3bp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BRI3BP mRNA CTD PMID:21215274 Bri3bp Rat 2-methylcholine affects expression ISO BRI3BP (Homo sapiens) 6480464 beta-methylcholine affects the expression of BRI3BP mRNA CTD PMID:21179406 Bri3bp Rat 3,4-methylenedioxymethamphetamine increases expression ISO Bri3bp (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of BRI3BP mRNA CTD PMID:20188158 Bri3bp Rat 3-methylcholanthrene increases expression ISO Bri3bp (Mus musculus) 6480464 Methylcholanthrene results in increased expression of BRI3BP mRNA CTD PMID:25926378 Bri3bp Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BRI3BP mRNA CTD PMID:30047161 Bri3bp Rat aflatoxin B1 decreases expression ISO Bri3bp (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of BRI3BP mRNA CTD PMID:19770486 Bri3bp Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BRI3BP mRNA CTD PMID:30047161 Bri3bp Rat aristolochic acid A increases expression ISO BRI3BP (Homo sapiens) 6480464 aristolochic acid I results in increased expression of BRI3BP mRNA CTD PMID:33212167 Bri3bp Rat arsane affects methylation ISO BRI3BP (Homo sapiens) 6480464 Arsenic affects the methylation of BRI3BP gene CTD PMID:25304211 Bri3bp Rat arsenic atom affects methylation ISO BRI3BP (Homo sapiens) 6480464 Arsenic affects the methylation of BRI3BP gene CTD PMID:25304211 Bri3bp Rat benzo[a]pyrene decreases expression ISO Bri3bp (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BRI3BP mRNA CTD PMID:19770486 Bri3bp Rat benzo[a]pyrene increases methylation ISO BRI3BP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of BRI3BP promoter CTD PMID:27901495 Bri3bp Rat bis(2-ethylhexyl) phthalate increases expression ISO Bri3bp (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BRI3BP mRNA CTD PMID:19850644 Bri3bp Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Bri3bp (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of BRI3BP mRNA] CTD PMID:19850644 Bri3bp Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of BRI3BP mRNA CTD PMID:26496021 Bri3bp Rat bisphenol A decreases methylation ISO BRI3BP (Homo sapiens) 6480464 bisphenol A results in decreased methylation of BRI3BP gene CTD PMID:31601247 Bri3bp Rat bisphenol A affects expression ISO BRI3BP (Homo sapiens) 6480464 bisphenol A affects the expression of BRI3BP mRNA CTD PMID:30903817 Bri3bp Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BRI3BP mRNA CTD PMID:25181051 Bri3bp Rat carbon nanotube increases expression ISO Bri3bp (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of BRI3BP mRNA CTD PMID:25554681 Bri3bp Rat CGP 52608 multiple interactions ISO BRI3BP (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BRI3BP gene] CTD PMID:28238834 Bri3bp Rat chromium(6+) multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of BRI3BP mRNA CTD PMID:38479592 Bri3bp Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of BRI3BP mRNA CTD PMID:30047161 Bri3bp Rat copper atom multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of BRI3BP mRNA CTD PMID:20971185 Bri3bp Rat copper(0) multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of BRI3BP mRNA CTD PMID:20971185 Bri3bp Rat copper(II) sulfate decreases expression ISO BRI3BP (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of BRI3BP mRNA CTD PMID:19549813 Bri3bp Rat coumestrol multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of BRI3BP mRNA CTD PMID:19167446 Bri3bp Rat Dibutyl phosphate affects expression ISO BRI3BP (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BRI3BP mRNA CTD PMID:37042841 Bri3bp Rat dimethylarsinic acid multiple interactions ISO Bri3bp (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BRI3BP mRNA CTD PMID:34876320 Bri3bp Rat dioxygen decreases expression ISO BRI3BP (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of BRI3BP mRNA CTD PMID:26516004 Bri3bp Rat dorsomorphin multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Bri3bp Rat doxorubicin decreases expression ISO BRI3BP (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BRI3BP mRNA CTD PMID:29803840 Bri3bp Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of BRI3BP mRNA CTD PMID:29391264 Bri3bp Rat Enterolactone multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of BRI3BP mRNA CTD PMID:19167446 Bri3bp Rat entinostat multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BRI3BP mRNA CTD PMID:27188386 Bri3bp Rat entinostat increases expression ISO BRI3BP (Homo sapiens) 6480464 entinostat results in increased expression of BRI3BP mRNA CTD PMID:26272509 and PMID:27188386 Bri3bp Rat inulin multiple interactions ISO Bri3bp (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of BRI3BP mRNA CTD PMID:36331819 Bri3bp Rat ivermectin decreases expression ISO BRI3BP (Homo sapiens) 6480464 Ivermectin results in decreased expression of BRI3BP protein CTD PMID:32959892 Bri3bp Rat lead(0) decreases expression ISO BRI3BP (Homo sapiens) 6480464 Lead results in decreased expression of BRI3BP mRNA CTD PMID:19921347 Bri3bp Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of BRI3BP mRNA CTD PMID:30047161 Bri3bp Rat methylarsonic acid multiple interactions ISO Bri3bp (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BRI3BP mRNA CTD PMID:34876320 Bri3bp Rat methylmercury chloride decreases expression ISO BRI3BP (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BRI3BP mRNA CTD PMID:28001369 Bri3bp Rat ozone multiple interactions ISO Bri3bp (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of BRI3BP mRNA CTD PMID:34911549 Bri3bp Rat panobinostat increases expression ISO BRI3BP (Homo sapiens) 6480464 panobinostat results in increased expression of BRI3BP mRNA CTD PMID:26272509 Bri3bp Rat paracetamol affects expression ISO Bri3bp (Mus musculus) 6480464 Acetaminophen affects the expression of BRI3BP mRNA CTD PMID:17562736 Bri3bp Rat paracetamol increases expression ISO BRI3BP (Homo sapiens) 6480464 Acetaminophen results in increased expression of BRI3BP mRNA CTD PMID:22230336 Bri3bp Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of BRI3BP mRNA CTD PMID:32680482 Bri3bp Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Bri3bp (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BRI3BP mRNA more ... CTD PMID:36331819 Bri3bp Rat perfluorooctanoic acid decreases expression ISO BRI3BP (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of BRI3BP protein CTD PMID:26879310 Bri3bp Rat perfluorooctanoic acid multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] results in decreased expression of BRI3BP mRNA CTD PMID:33325755 Bri3bp Rat phytoestrogen multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] results in decreased expression of BRI3BP mRNA CTD PMID:33325755 Bri3bp Rat pirinixic acid increases expression ISO Bri3bp (Mus musculus) 6480464 pirinixic acid results in increased expression of BRI3BP mRNA CTD PMID:18301758 and PMID:20813756 Bri3bp Rat resveratrol increases expression ISO Bri3bp (Mus musculus) 6480464 resveratrol results in increased expression of BRI3BP protein CTD PMID:25505154 Bri3bp Rat SB 431542 multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Bri3bp Rat sodium arsenate multiple interactions ISO Bri3bp (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BRI3BP mRNA CTD PMID:34876320 Bri3bp Rat sodium arsenite increases expression ISO BRI3BP (Homo sapiens) 6480464 sodium arsenite results in increased expression of BRI3BP mRNA CTD PMID:28595984 and PMID:34032870 Bri3bp Rat sodium arsenite multiple interactions ISO Bri3bp (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of BRI3BP mRNA CTD PMID:34876320 Bri3bp Rat sodium arsenite decreases expression ISO BRI3BP (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BRI3BP mRNA CTD PMID:38568856 Bri3bp Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BRI3BP mRNA CTD PMID:30047161 Bri3bp Rat sunitinib increases expression ISO BRI3BP (Homo sapiens) 6480464 Sunitinib results in increased expression of BRI3BP mRNA CTD PMID:31533062 Bri3bp Rat temozolomide increases expression ISO BRI3BP (Homo sapiens) 6480464 Temozolomide results in increased expression of BRI3BP mRNA CTD PMID:31758290 Bri3bp Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BRI3BP mRNA] CTD PMID:31150632 Bri3bp Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of BRI3BP mRNA CTD PMID:31150632 Bri3bp Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of BRI3BP mRNA CTD PMID:30012374 Bri3bp Rat titanium dioxide increases methylation ISO Bri3bp (Mus musculus) 6480464 titanium dioxide results in increased methylation of BRI3BP gene CTD PMID:35295148 Bri3bp Rat trichostatin A increases expression ISO BRI3BP (Homo sapiens) 6480464 trichostatin A results in increased expression of BRI3BP mRNA CTD PMID:24935251 and PMID:26272509 Bri3bp Rat trimellitic anhydride increases expression ISO Bri3bp (Mus musculus) 6480464 trimellitic anhydride results in increased expression of BRI3BP mRNA CTD PMID:19042947 Bri3bp Rat valproic acid increases expression ISO BRI3BP (Homo sapiens) 6480464 Valproic Acid results in increased expression of BRI3BP mRNA CTD PMID:23179753 more ... Bri3bp Rat valproic acid multiple interactions ISO BRI3BP (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BRI3BP mRNA CTD PMID:27188386
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chromium(6+) (ISO) clotrimazole (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Dibutyl phosphate (ISO) dimethylarsinic acid (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) inulin (ISO) ivermectin (ISO) lead(0) (ISO) methimazole (EXP) methylarsonic acid (ISO) methylmercury chloride (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phytoestrogen (ISO) pirinixic acid (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (EXP) titanium dioxide (EXP,ISO) trichostatin A (ISO) trimellitic anhydride (ISO) valproic acid (ISO)
Bri3bp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 36,838,098 - 36,849,919 (-) NCBI GRCr8 mRatBN7.2 12 31,176,742 - 31,188,563 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 31,173,971 - 31,188,572 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 32,347,442 - 32,359,299 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 32,958,867 - 32,970,726 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 32,010,791 - 32,022,648 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 36,576,018 - 36,587,839 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 36,576,020 - 36,587,839 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 38,445,350 - 38,457,171 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 32,270,907 - 32,282,728 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 12 32,871,267 - 32,883,085 (-) NCBI Celera Cytogenetic Map 12 q14 NCBI
BRI3BP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 124,993,645 - 125,051,167 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 124,993,645 - 125,031,231 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 125,478,191 - 125,515,777 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 124,044,147 - 124,076,302 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 124,003,073 - 124,035,229 NCBI Celera 12 125,079,837 - 125,113,892 (+) NCBI Celera Cytogenetic Map 12 q24.31 NCBI HuRef 12 122,460,787 - 122,474,086 (+) NCBI HuRef CHM1_1 12 125,299,491 - 125,331,625 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 124,998,843 - 125,059,692 (+) NCBI T2T-CHM13v2.0
Bri3bp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 125,518,632 - 125,537,949 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 125,518,632 - 125,537,434 (+) Ensembl GRCm39 Ensembl GRCm38 5 125,441,568 - 125,460,885 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 125,441,568 - 125,460,370 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 125,921,938 - 125,941,255 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 125,730,944 - 125,750,261 (+) NCBI MGSCv36 mm8 Celera 5 122,463,614 - 122,482,895 (+) NCBI Celera Cytogenetic Map 5 G1.1 NCBI cM Map 5 64.21 NCBI
Bri3bp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955482 4,710,937 - 4,716,534 (-) NCBI ChiLan1.0 ChiLan1.0
BRI3BP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 133,080,656 - 133,120,590 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 133,077,046 - 133,116,968 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 122,587,345 - 122,627,273 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 126,891,051 - 126,904,267 (+) NCBI panpan1.1 PanPan1.1 panPan2
BRI3BP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 4,938,835 - 4,961,552 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 5,093,905 - 5,121,184 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 5,176,412 - 5,203,707 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 5,180,807 - 5,203,707 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 5,114,537 - 5,141,810 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 5,203,968 - 5,231,236 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 5,157,906 - 5,185,163 (-) NCBI UU_Cfam_GSD_1.0
Bri3bp
BRI3BP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 28,180,103 - 28,202,072 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 28,180,130 - 28,202,106 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 29,887,796 - 29,904,793 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BRI3BP
Bri3bp
.
Predicted Target Of
Count of predictions: 257 Count of miRNA genes: 176 Interacting mature miRNAs: 198 Transcripts: ENSRNOT00000001295 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 70169 Eae13 Experimental allergic encephalomyelitis QTL 13 0.032 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 12 24139202 36638073 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1556747 Calcic1 Intracellular calcium level QTL 1 3.6 platelet calcium amount (VT:0010500) platelet intracellular calcium level (CMO:0000922) 12 28064433 40130419 Rat 631829 Alc6 Alcohol consumption QTL 6 4.7 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 28607526 37691617 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 1331763 Wbc2 White blood cell count QTL 2 3.162 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 12 24234777 31894213 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 1331787 Rf41 Renal function QTL 41 2.998 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 12 28064557 40218380 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
RH135352
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 31,177,062 - 31,177,257 (+) MAPPER mRatBN7.2 Rnor_6.0 12 36,576,339 - 36,576,533 NCBI Rnor6.0 Rnor_5.0 12 38,445,671 - 38,445,865 UniSTS Rnor5.0 RGSC_v3.4 12 32,271,228 - 32,271,422 UniSTS RGSC3.4 Celera 12 32,871,588 - 32,871,782 UniSTS RH 3.4 Map 12 471.9 UniSTS Cytogenetic Map 12 q14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001295 ⟹ ENSRNOP00000001295
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 36,576,020 - 36,587,839 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104714 ⟹ ENSRNOP00000092844
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,173,971 - 31,188,572 (-) Ensembl
RefSeq Acc Id:
NM_001017487 ⟹ NP_001017487
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 36,838,098 - 36,849,919 (-) NCBI mRatBN7.2 12 31,176,742 - 31,188,563 (-) NCBI Rnor_6.0 12 36,576,018 - 36,587,839 (-) NCBI Rnor_5.0 12 38,445,350 - 38,457,171 (-) NCBI RGSC_v3.4 12 32,270,907 - 32,282,728 (-) RGD Celera 12 32,871,267 - 32,883,085 (-) RGD
Sequence:
CTCCTCCCTTGGCCGACATGGGCGCGCGCGCGTCCCAGGAGCCCTGGGCCCGGGTCCTGGTCGGGCTGCGGGTGCTGCTGTCGGTTCTACTTCTGACCCTGCTGCTGCTGTCGCTGGTGGCTCCTGGA
hide sequence
RefSeq Acc Id:
NP_001017487 ⟸ NM_001017487
- Peptide Label:
precursor
- UniProtKB:
Q5U3Z5 (UniProtKB/TrEMBL), A0A8I6AHD0 (UniProtKB/TrEMBL)
- Sequence:
MGARASQEPWARVLVGLRVLLSVLLLTLLLLSLVAPGAQGARGRGTADKNSHRRATSSFSQSVSSLFGEDNVRAAQKLLSRLTERFVQGVDMFLETLWKIWMELLEVLGLDVSNLSQYFSPASVSNSP
hide sequence
Ensembl Acc Id:
ENSRNOP00000001295 ⟸ ENSRNOT00000001295
Ensembl Acc Id:
ENSRNOP00000092844 ⟸ ENSRNOT00000104714
RGD ID: 13698600 Promoter ID: EPDNEW_R9124 Type: initiation region Name: Bri3bp_1 Description: Bri3 binding protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 36,587,907 - 36,587,967 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-05
Bri3bp
Bri3 binding protein
LOC498176
similar to BRI3-binding protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC498176
similar to BRI3-binding protein
Symbol and Name status set to provisional
70820 PROVISIONAL
