Advanced Search (OLGA)

Gene: Tmem141 (transmembrane protein 141) Rattus norvegicus

Analyze

Symbol:

Tmem141

Name:

transmembrane protein 141

RGD ID:

1561492

Description:

Orthologous to human TMEM141 (transmembrane protein 141); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC499755; RGD1561492; similar to hypothetical protein MGC14141

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM141 (transmembrane protein 141)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Tmem141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tmem141 (transmembrane protein 141)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TMEM141 (transmembrane protein 141)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tmem141 (transmembrane protein 141)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem141 (transmembrane protein 141)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tmem141 (transmembrane protein 141)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG42488	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG42488	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem141	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tmem141	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	28,837,665 - 28,839,623 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	28,836,576 - 28,839,623 (-)	Ensembl				GRCr8
mRatBN7.2	3	8,439,533 - 8,441,491 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	8,439,533 - 8,441,491 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	11,544,685 - 11,546,645 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	20,130,911 - 20,132,871 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	18,320,759 - 18,322,720 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	2,843,635 - 2,845,593 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	2,843,635 - 2,845,593 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	2,825,048 - 2,827,006 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	3,791,545 - 3,793,503 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	3,264,475 - 3,266,433 (-)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

developmental and epileptic encephalopathy 14 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

corosolic acid (ISO)

cyclosporin A (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

ethanol (ISO)

finasteride (EXP)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

isoprenaline (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulindac (EXP)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

thiram (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrion (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:34800366

Genomics

Comparative Map Data

Tmem141
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	28,837,665 - 28,839,623 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	28,836,576 - 28,839,623 (-)	Ensembl				GRCr8
mRatBN7.2	3	8,439,533 - 8,441,491 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	8,439,533 - 8,441,491 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	11,544,685 - 11,546,645 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	20,130,911 - 20,132,871 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	18,320,759 - 18,322,720 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	2,843,635 - 2,845,593 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	2,843,635 - 2,845,593 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	2,825,048 - 2,827,006 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	3,791,545 - 3,793,503 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	3,264,475 - 3,266,433 (-)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

TMEM141
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	136,791,344 - 136,793,317 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	136,791,303 - 136,793,317 (+)	Ensembl			hg38	GRCh38
GRCh37	9	139,685,796 - 139,687,769 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	138,805,598 - 138,807,590 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	9	110,199,411 - 110,201,403 (+)	NCBI		Celera
Cytogenetic Map	9	q34.3	NCBI
HuRef	9	109,144,662 - 109,146,654 (+)	NCBI		HuRef
CHM1_1	9	139,834,511 - 139,836,503 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	149,024,225 - 149,026,198 (+)	NCBI		T2T-CHM13v2.0

Tmem141
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	25,510,078 - 25,512,059 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	25,510,079 - 25,512,017 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	25,620,066 - 25,622,047 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	25,620,067 - 25,622,005 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	25,475,586 - 25,477,525 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	25,442,075 - 25,444,014 (-)	NCBI		MGSCv36	mm8
Celera	2	25,348,386 - 25,350,325 (-)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	17.57	NCBI

Tmem141
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	4,892,674 - 4,894,371 (+)	Ensembl
ChiLan1.0	NW_004955513	4,892,650 - 4,894,371 (+)	NCBI	ChiLan1.0	ChiLan1.0

TMEM141
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	2,608,174 - 2,610,138 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	2,610,509 - 2,612,473 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	107,849,421 - 107,851,438 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	136,819,129 - 136,821,071 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

TMEM141
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	48,777,694 - 48,779,518 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	48,777,958 - 48,779,448 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	47,991,305 - 48,003,376 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	49,655,836 - 49,657,598 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	9	48,431,979 - 48,433,741 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	48,730,644 - 48,742,703 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	48,777,643 - 48,779,405 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tmem141
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	202,259,628 - 202,272,357 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936669	1,114,321 - 1,115,474 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936669	1,102,653 - 1,115,411 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM141
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	1	313,877,030 - 313,878,950 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM141
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	1,393,836 - 1,395,816 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	1,393,944 - 1,395,740 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666058	3,878,027 - 3,880,032 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem141
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	1,038,579 - 1,040,239 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624760	1,038,579 - 1,040,250 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tmem141
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	11,557,366 - 11,559,264 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tmem141
6 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	300
Count of miRNA genes:	198
Interacting mature miRNAs:	225
Transcripts:	ENSRNOT00000067479
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
10450811	Scl73	Serum cholesterol level QTL 73	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
2292615	Ept17	Estrogen-induced pituitary tumorigenesis QTL 17	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat
10450808	Scl72	Serum cholesterol level QTL 72	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
10450806	Scl71	Serum cholesterol level QTL 71	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	2904329	47904329	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	6125437	51125437	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	36721849	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	6556347	51556347	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	22677150	50766390	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	15272348	60272348	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	5766390	50766390	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358185	Ept6	Estrogen-induced pituitary tumorigenesis QTL 6	6.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	6556347	51556347	Rat

Markers in Region

RH134501

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	28,838,011 - 28,838,723 (+)	Marker Load Pipeline
Cytogenetic Map	3	p13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	90	59	6	354	190	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067479 ⟹ ENSRNOP00000060870

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	28,836,576 - 28,839,623 (-)	Ensembl
mRatBN7.2 Ensembl	3	8,439,533 - 8,441,491 (-)	Ensembl
Rnor_6.0 Ensembl	3	2,843,635 - 2,845,593 (-)	Ensembl

RefSeq Acc Id:

NM_001109197 ⟹ NP_001102667

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	28,837,665 - 28,839,623 (-)	NCBI
mRatBN7.2	3	8,439,533 - 8,441,491 (-)	NCBI
Rnor_6.0	3	2,843,635 - 2,845,593 (-)	NCBI
Rnor_5.0	3	2,825,048 - 2,827,006 (-)	NCBI
RGSC_v3.4	3	3,791,545 - 3,793,503 (-)	RGD
Celera	3	3,264,475 - 3,266,433 (-)	RGD

Sequence:

show sequence

CCTTGGCGGAACCTGACCAACCATGGTGAATCTGGGCCTGTCCCGTGTAGATGACGCCGTCGCC
GCCAAGCACCCGGGACTCGAGGAATATGCTGCCTGCCAGTCGAACGCCTTCATGAAAGGCGTTT
TCACTTTTGTCACAGGCACTGGTGTGACTTTTGGCCTGCAGATGTTCATTAAGAGGAAGTTTCC
ATACCCTGTGCAGTGGGGCTTCCTGGTGTCTGCCGTTGTAGGATCTGTGGCCAGCTACAGAGTG
ACAAGAATGGAGTGTCAGAAATGCAGCAATCTGTGGCTCTTCCTGGAGACCGGGCAGCTCCCCA
AAGGCATGAGCACAGATCACAACAACTAGAAGAGCTCTGGCTGCTGGAGTGTGTAGGATGTGAG
GTGGGGAAGAGCCTAGAGCACAGACTTGGACAGCATCTAACTCCAGGCTGGTCCTTCCTAGCTC
ACCAAATACACAAACAAGCATGTGTCATCTCTCTCCTACACGCACATGGGGGAGCTGCCTGAGA
AACCTGTGAAGATCACTGCTGCTGTGAAGATCCATCCAGGATTTGCCAGGGAGGCCAGCTCAGA
AAAGGACTTGGGAGAGGGGGATCTCTTCCAGAGCAGCAAGGAGCCAGGGTATCGTTTTGGATCC
TGTCACACACAACTGTTGGGGCAACAGCCTGCGTGTGGCGCTTTCTGTGGTGCTTTGGGGCCCT
TATCTGACATGTAGGCCCCAAAATCCAAGGAGAATGTTGGAGAGTTGTAGCTAATAAATGGCTT
GTCCTTTTTCCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102667	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93555	(Get FASTA)	NCBI Sequence Viewer
	EDL93556	(Get FASTA)	NCBI Sequence Viewer
	EDL93557	(Get FASTA)	NCBI Sequence Viewer
	EDL93558	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060870.2

RefSeq Acc Id:	NP_001102667 ⟸ NM_001109197
- UniProtKB:	D3ZK53 (UniProtKB/TrEMBL), A6JT91 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVNLGLSRVDDAVAAKHPGLEEYAACQSNAFMKGVFTFVTGTGVTFGLQMFIKRKFPYPVQWGF LVSAVVGSVASYRVTRMECQKCSNLWLFLETGQLPKGMSTDHNN hide sequence

Ensembl Acc Id:

ENSRNOP00000060870 ⟸ ENSRNOT00000067479

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZK53-F1-model_v2	AlphaFold	D3ZK53	1-108	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691887

Promoter ID:

EPDNEW_R2411

Type:

initiation region

Name:

Tmem141_1

Description:

transmembrane protein 141

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	2,845,600 - 2,845,660	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561492	AgrOrtholog
BioCyc Gene	G2FUF-50435	BioCyc
Ensembl Genes	ENSRNOG00000028254	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000067479.3	UniProtKB/TrEMBL
Gene3D-CATH	1.10.3350.20	UniProtKB/TrEMBL
InterPro	Tmem141	UniProtKB/TrEMBL
	Tmem141_sf	UniProtKB/TrEMBL
KEGG Report	rno:499755	UniProtKB/TrEMBL
NCBI Gene	499755	ENTREZGENE
PANTHER	PTHR47229	UniProtKB/TrEMBL
	TRANSMEMBRANE PROTEIN 141	UniProtKB/TrEMBL
Pfam	TMEM141	UniProtKB/TrEMBL
PhenoGen	Tmem141	PhenoGen
RatGTEx	ENSRNOG00000028254	RatGTEx
UniProt	A6JT91	ENTREZGENE, UniProtKB/TrEMBL
	D3ZK53	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-29	Tmem141	transmembrane protein 141	RGD1561492_predicted	similar to hypothetical protein MGC14141 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1561492_predicted	similar to hypothetical protein MGC14141 (predicted)	LOC499755	similar to hypothetical protein MGC14141	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499755	similar to hypothetical protein MGC14141			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar