C1qtnf2 (C1q and TNF related 2) - Rat Genome Database

Name: C1qtnf2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: C1qtnf2 (C1q and TNF related 2) Rattus norvegicus

Analyze

Symbol:

C1qtnf2

Name:

C1q and TNF related 2

RGD ID:

1561041

Description:

Predicted to enable identical protein binding activity and signaling receptor binding activity. Predicted to be involved in regulation of lipid metabolic process. Predicted to act upstream of or within positive regulation of D-glucose import; positive regulation of MAPK cascade; and positive regulation of small molecule metabolic process. Predicted to be located in extracellular space. Predicted to be part of protein-containing complex. Orthologous to human C1QTNF2 (C1q and TNF related 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol; atrazine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Adih; adiponectin h; C1q and tumor necrosis factor related protein 2; complement C1q tumor necrosis factor-related protein 2; Ctrp2; LOC497886; RGD1561041; similar to C1q and tumor necrosis factor related protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	C1QTNF2 (C1q and TNF related 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	C1qtnf2 (C1q and tumor necrosis factor related protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	C1qtnf2 (C1q and TNF related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	C1QTNF2 (C1q and TNF related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	C1QTNF2 (C1q and TNF related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	C1qtnf2 (C1q and TNF related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	C1QTNF2 (C1q and TNF related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	C1QTNF2 (C1q and TNF related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	C1qtnf2 (C1q and TNF related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	C1QTNF2 (C1q and TNF related 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	C1qtnf2 (C1q and tumor necrosis factor related protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	c1qtnf2 (C1q and TNF related 2)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	28,443,326 - 28,460,400 (+)	NCBI		GRCr8
mRatBN7.2	10	27,941,948 - 27,958,926 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	27,941,948 - 27,959,185 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	32,702,345 - 32,719,322 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	1,240,729 - 1,257,709 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	27,672,923 - 27,689,866 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	29,067,102 - 29,084,035 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	29,067,102 - 29,084,035 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	28,909,018 - 28,925,541 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	28,571,051 - 28,588,714 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	27,434,824 - 27,451,717 (+)	NCBI		Celera
Cytogenetic Map	10	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (ISO)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (ISO)

chromium(6+) (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP)

diiodine (ISO)

dioxygen (ISO)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

entinostat (ISO)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

iron dichloride (ISO)

methapyrilene (ISO)

methoxyacetic acid (EXP)

orphenadrine (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

potassium chromate (ISO)

potassium dichromate (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

Theaflavin 3,3'-digallate (ISO)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of D-glucose import (ISO)

positive regulation of fatty acid oxidation (ISO)

positive regulation of glycogen biosynthetic process (ISO)

positive regulation of MAPK cascade (ISO)

regulation of lipid metabolic process (ISO)

Cellular Component

extracellular space (ISO)

protein-containing complex (ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

signaling receptor binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15231994	PMID:17716811	PMID:18783346	PMID:31439668

Genomics

Comparative Map Data

C1qtnf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	28,443,326 - 28,460,400 (+)	NCBI		GRCr8
mRatBN7.2	10	27,941,948 - 27,958,926 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	27,941,948 - 27,959,185 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	32,702,345 - 32,719,322 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	1,240,729 - 1,257,709 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	27,672,923 - 27,689,866 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	29,067,102 - 29,084,035 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	29,067,102 - 29,084,035 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	28,909,018 - 28,925,541 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	28,571,051 - 28,588,714 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	27,434,824 - 27,451,717 (+)	NCBI		Celera
Cytogenetic Map	10	q21	NCBI

C1QTNF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	160,347,754 - 160,370,626 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	160,347,754 - 160,370,641 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	159,774,761 - 159,797,633 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	159,707,339 - 159,730,226 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	159,707,356 - 159,730,207	NCBI
Celera	5	155,807,245 - 155,830,113 (-)	NCBI		Celera
Cytogenetic Map	5	q33.3	NCBI
HuRef	5	154,868,511 - 154,891,382 (-)	NCBI		HuRef
CHM1_1	5	159,207,652 - 159,230,548 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	160,876,282 - 160,899,121 (-)	NCBI		T2T-CHM13v2.0

C1qtnf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	43,364,984 - 43,382,485 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	43,365,103 - 43,382,352 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	43,474,306 - 43,491,525 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	43,474,276 - 43,491,525 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	43,287,846 - 43,305,027 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	43,317,763 - 43,334,948 (+)	NCBI		MGSCv36	mm8
MGSCv36	11	43,815,568 - 43,832,825 (+)	NCBI		MGSCv36	mm8
Celera	11	48,098,345 - 48,116,759 (+)	NCBI		Celera
Cytogenetic Map	11	B1.1	NCBI
cM Map	11	25.72	NCBI

C1qtnf2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	14,218,502 - 14,240,252 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	14,219,263 - 14,266,832 (-)	NCBI	ChiLan1.0	ChiLan1.0

C1QTNF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	155,534,613 - 155,556,147 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	153,669,254 - 153,695,693 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	155,738,893 - 155,761,650 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	162,433,415 - 162,456,123 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	162,433,415 - 162,456,123 (-)	Ensembl	panpan1.1		panPan2

C1QTNF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	50,352,245 - 50,372,412 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	50,367,910 - 50,372,597 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	50,247,737 - 50,268,070 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	50,787,605 - 50,807,939 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	50,787,388 - 50,808,540 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	50,596,009 - 50,616,311 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	50,719,773 - 50,740,067 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	51,240,059 - 51,260,605 (+)	NCBI		UU_Cfam_GSD_1.0

C1qtnf2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	104,758,722 - 104,778,624 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936515	3,208,061 - 3,228,225 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936515	3,208,042 - 3,227,970 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C1QTNF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	63,167,184 - 63,189,815 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	63,167,087 - 63,185,938 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	68,538,952 - 68,557,980 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C1QTNF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	62,709,899 - 62,729,828 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	62,707,090 - 62,716,171 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	14,872,708 - 14,895,784 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

C1qtnf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	29,193,290 - 29,215,675 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	29,193,020 - 29,216,557 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in C1qtnf2
173 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	119
Count of miRNA genes:	97
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000005161
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	27957626	34490668	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum immunoglobulin E level (CMO:0002101)	10	22918268	36400810	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

RH137984

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	27,942,456 - 27,942,648 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	29,067,569 - 29,067,760	NCBI	Rnor6.0
Rnor_5.0	10	28,909,485 - 28,909,676	UniSTS	Rnor5.0
RGSC_v3.4	10	28,571,518 - 28,571,709	UniSTS	RGSC3.4
Celera	10	27,435,291 - 27,435,482	UniSTS
RH 3.4 Map	10	293.5	UniSTS
Cytogenetic Map	10	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006246141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LT963074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005161 ⟹ ENSRNOP00000005161

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	27,941,948 - 27,958,933 (+)	Ensembl
Rnor_6.0 Ensembl	10	29,067,102 - 29,084,035 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097801 ⟹ ENSRNOP00000077656

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	27,954,929 - 27,959,185 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101070 ⟹ ENSRNOP00000095030

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	27,942,023 - 27,959,185 (+)	Ensembl

RefSeq Acc Id:

NM_001191918 ⟹ NP_001178847

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	28,443,455 - 28,460,389 (+)	NCBI
mRatBN7.2	10	27,941,990 - 27,958,926 (+)	NCBI
Rnor_6.0	10	29,067,102 - 29,084,035 (+)	NCBI
Rnor_5.0	10	28,909,018 - 28,925,541 (+)	NCBI
Celera	10	27,434,824 - 27,451,717 (+)	NCBI

Sequence:

show sequence

CAAGCTGCTGCAAGCAGGACTGAGCACTACCAGAGCAGCAACCTCGGATGGCCCTGGACGTGGC
ACGCGCGGGGCACAGAGGCAAGAAGACTTGATGAAGCCTCTCTTCCCAACCCATATCCAGAAAG
AACGATTTAGATGACAGTTTTTAGAAAGGTGACCACCATGATCTCCTGGATGCTCTTGGCCTGT
GCCCTTCCGTGTGCTGCTGACCCAATGCTTGGTGCCTTTGCTCGCAGGGACTTCCAGAAGGGTG
GTCCTCAACTGGTGTGCAGTCTGCCTGGTCCCCAAGGCCCACCTGGCCCTCCAGGAGCACCAGG
ATCCTCAGGAATGGTGGGAAGAATGGGTTTTCCTGGTAAAGATGGCCAAGACGGCCAGGACGGA
GACCGAGGGGACAGTGGAGAAGAAGGTCCACCTGGCAGGACAGGCAACCGAGGAAAACAAGGAC
CAAAGGGCAAAGCTGGGGCCATTGGGAGAGCGGGTCCTCGAGGACCCAAGGGGGTCAGTGGTAC
CCCCGGGAAACATGGTATACCGGGCAAGAAGGGACCTAAGGGCAAGAAAGGGGAACCTGGGCTC
CCAGGCCCCTGTAGCTGCGGCAGTAGCCGAGCCAAGTCGGCCTTTTCGGTGGCGGTAACCAAGA
GTTACCCACGTGAGCGACTGCCCATCAAGTTTGACAAGATTCTGATGAATGAGGGAGGCCACTA
CAATGCATCCAGTGGCAAGTTCGTCTGCAGCGTGCCAGGGATCTATTACTTTACCTATGACATT
ACGCTGGCCAACAAACACCTGGCCATCGGCCTAGTGCACAATGGCCAGTACCGCATTCGGACTT
TTGACGCCAACACCGGCAACCACGACGTGGCCTCGGGCTCCACCATCCTAGCTCTCAAGGAGGG
TGATGAAGTCTGGTTACAGATTTTCTACTCGGAGCAGAATGGACTCTTCTACGACCCTTATTGG
ACCGACAGCCTGTTCACCGGCTTCCTCATCTACGCTGATCAAGGAGACCCCAATGAGGTATAGA
CAAGCTGGGGTTGAGCGTCCAGGCAGGGACTAAGATTCCGCAAGGGTGCTGATAGAAGAGGATC
TCTGAACTGAGGCTGGGGACTGGCAGTCTTGGGAGCTTTTATTCCCAGGCAAGCCTCCTCTGTT
GCTGCTTTAAAAAAACAAAAAACAAAAAAAACAAAACAAAACAAAAAAAAAACATTAAATCCAA

hide sequence

RefSeq Acc Id:

XM_039086544 ⟹ XP_038942472

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	28,443,326 - 28,460,400 (+)	NCBI
mRatBN7.2	10	27,941,948 - 27,958,914 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178847	(Get FASTA)	NCBI Sequence Viewer
	XP_038942472	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM04135	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005161.4
	ENSRNOP00000077656.1
	ENSRNOP00000095030.1
GenBank Protein	SOR70292	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001178847 ⟸ NM_001191918
- Peptide Label:	precursor
- UniProtKB:	A0A8I6AKQ7 (UniProtKB/TrEMBL), A0A3B0J1M6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTVFRKVTTMISWMLLACALPCAADPMLGAFARRDFQKGGPQLVCSLPGPQGPPGPPGAPGSSG MVGRMGFPGKDGQDGQDGDRGDSGEEGPPGRTGNRGKQGPKGKAGAIGRAGPRGPKGVSGTPGK HGIPGKKGPKGKKGEPGLPGPCSCGSSRAKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNAS SGKFVCSVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKEGDEV WLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQGDPNEV hide sequence

Ensembl Acc Id:

ENSRNOP00000005161 ⟸ ENSRNOT00000005161

RefSeq Acc Id:	XP_038942472 ⟸ XM_039086544
- Peptide Label:	isoform X1
- UniProtKB:	D3ZCS2 (UniProtKB/TrEMBL), A0A3B0J1M6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000077656 ⟸ ENSRNOT00000097801

Ensembl Acc Id:

ENSRNOP00000095030 ⟸ ENSRNOT00000101070

Protein Domains

C1q

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZCS2-F1-model_v2	AlphaFold	D3ZCS2	1-294	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697113

Promoter ID:

EPDNEW_R7638

Type:

initiation region

Name:

C1qtnf2_1

Description:

C1q and TNF related 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	29,067,083 - 29,067,143	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561041	AgrOrtholog
BioCyc Gene	G2FUF-25453	BioCyc
Ensembl Genes	ENSRNOG00000003870	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005161.6	UniProtKB/TrEMBL
	ENSRNOT00000097801.1	UniProtKB/TrEMBL
	ENSRNOT00000101070.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.40	UniProtKB/TrEMBL
InterPro	C1q	UniProtKB/TrEMBL
	Collagen	UniProtKB/TrEMBL
	Collagen/C1q_domain	UniProtKB/TrEMBL
	Tumour_necrosis_fac-like	UniProtKB/TrEMBL
KEGG Report	rno:497886	UniProtKB/TrEMBL
NCBI Gene	497886	ENTREZGENE
PANTHER	COMPLEMENT C1Q TUMOR NECROSIS FACTOR-RELATED PROTEIN 2	UniProtKB/TrEMBL
	EMILIN ELASTIN MICROFIBRIL INTERFACE-LOCATED PROTEIN ELASTIN MICROFIBRIL INTERFACER	UniProtKB/TrEMBL
Pfam	C1q	UniProtKB/TrEMBL
	Collagen	UniProtKB/TrEMBL
PhenoGen	C1qtnf2	PhenoGen
PRINTS	COMPLEMNTC1Q	UniProtKB/TrEMBL
PROSITE	C1Q	UniProtKB/TrEMBL
	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003870	RatGTEx
SMART	C1Q	UniProtKB/TrEMBL
Superfamily-SCOP	TNF_like	UniProtKB/TrEMBL
UniProt	A0A3B0J1M6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AKQ7	ENTREZGENE, UniProtKB/TrEMBL
	D3ZCS2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-09	C1qtnf2	C1q and TNF related 2	C1qtnf2	C1q and tumor necrosis factor related protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-28	C1qtnf2	C1q and tumor necrosis factor related protein 2	RGD1561041_predicted	similar to C1q and tumor necrosis factor related protein 2 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1561041_predicted	similar to C1q and tumor necrosis factor related protein 2 (predicted)	LOC497886	similar to C1q and tumor necrosis factor related protein 2	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC497886	similar to C1q and tumor necrosis factor related protein 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message