Symbol:
Bbs10
Name:
Bardet-Biedl syndrome 10
RGD ID:
1560748
Description:
Predicted to enable RNA polymerase II-specific DNA-binding transcription factor binding activity. Predicted to be involved in chaperone-mediated protein complex assembly; non-motile cilium assembly; and photoreceptor cell maintenance. Predicted to act upstream of or within several processes, including neuronal action potential; retina morphogenesis in camera-type eye; and visual perception. Human ortholog(s) of this gene implicated in Bardet-Biedl syndrome and Bardet-Biedl syndrome 10. Orthologous to human BBS10 (Bardet-Biedl syndrome 10); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Bardet-Biedl syndrome 10 (human); LOC500832; RGD1560748; similar to hypothetical protein FLJ23560
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 48,637,324 - 48,640,395 (+) NCBI GRCr8 mRatBN7.2 7 46,751,028 - 46,754,132 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 46,750,993 - 46,754,141 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 48,650,683 - 48,653,709 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 50,853,830 - 50,856,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 50,631,584 - 50,634,610 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 54,030,229 - 54,034,354 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 54,031,316 - 54,034,350 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 50,317,863 - 50,320,886 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 43,552,129 - 43,555,152 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bbs10 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO BBS10 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BBS10 mRNA CTD PMID:22079256 Bbs10 Rat 1,2-dimethylhydrazine decreases expression ISO Bbs10 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BBS10 mRNA CTD PMID:22206623 Bbs10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BBS10 mRNA CTD PMID:32109520 Bbs10 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bbs10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BBS10 mRNA CTD PMID:31961203 Bbs10 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Bbs10 Rat 2-hydroxypropanoic acid decreases expression ISO BBS10 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BBS10 mRNA CTD PMID:30851411 Bbs10 Rat 4,4'-sulfonyldiphenol decreases expression ISO Bbs10 (Mus musculus) 6480464 bisphenol S results in decreased expression of BBS10 mRNA CTD PMID:39298647 Bbs10 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat aflatoxin M1 decreases expression ISO BBS10 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of BBS10 mRNA CTD PMID:30928695 Bbs10 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat benzo[a]pyrene affects methylation ISO BBS10 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BBS10 promoter CTD PMID:27901495 Bbs10 Rat bis(2-ethylhexyl) phthalate increases expression ISO Bbs10 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BBS10 mRNA CTD PMID:21318169 and PMID:34319233 Bbs10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BBS10 mRNA CTD PMID:25181051 and PMID:32145629 Bbs10 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of BBS10 gene CTD PMID:28505145 Bbs10 Rat cadmium dichloride decreases expression ISO BBS10 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of BBS10 mRNA CTD PMID:38568856 Bbs10 Rat calcitriol increases expression ISO BBS10 (Homo sapiens) 6480464 Calcitriol results in increased expression of BBS10 mRNA CTD PMID:16002434 Bbs10 Rat carbon nanotube increases expression ISO Bbs10 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of BBS10 mRNA CTD PMID:25620056 Bbs10 Rat chlorpyrifos decreases expression ISO Bbs10 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of BBS10 mRNA CTD PMID:37019170 Bbs10 Rat cisplatin decreases expression ISO BBS10 (Homo sapiens) 6480464 Cisplatin results in decreased expression of BBS10 mRNA CTD PMID:27392435 Bbs10 Rat copper(II) sulfate decreases expression ISO BBS10 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of BBS10 mRNA CTD PMID:19549813 Bbs10 Rat cyclosporin A decreases expression ISO BBS10 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BBS10 mRNA CTD PMID:20106945 more ... Bbs10 Rat Dibutyl phosphate affects expression ISO BBS10 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of BBS10 mRNA CTD PMID:37042841 Bbs10 Rat dicrotophos decreases expression ISO BBS10 (Homo sapiens) 6480464 dicrotophos results in decreased expression of BBS10 mRNA CTD PMID:28302478 Bbs10 Rat dorsomorphin multiple interactions ISO BBS10 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BBS10 mRNA CTD PMID:27188386 Bbs10 Rat doxorubicin decreases expression ISO BBS10 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BBS10 mRNA CTD PMID:29803840 Bbs10 Rat formaldehyde increases expression ISO BBS10 (Homo sapiens) 6480464 Formaldehyde results in increased expression of BBS10 mRNA CTD PMID:23649840 Bbs10 Rat furan decreases expression ISO Bbs10 (Mus musculus) 6480464 furan results in decreased expression of BBS10 mRNA CTD PMID:24183702 Bbs10 Rat furan decreases expression EXP 6480464 furan results in decreased expression of BBS10 mRNA CTD PMID:25539665 Bbs10 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat Monobutylphthalate decreases expression EXP 6480464 monobutyl phthalate results in decreased expression of BBS10 mRNA CTD PMID:29162477 Bbs10 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat phenobarbital affects expression ISO BBS10 (Homo sapiens) 6480464 Phenobarbital affects the expression of BBS10 mRNA CTD PMID:19159669 Bbs10 Rat potassium chromate decreases expression ISO BBS10 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of BBS10 mRNA CTD PMID:22079256 Bbs10 Rat potassium chromate multiple interactions ISO BBS10 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BBS10 mRNA CTD PMID:22079256 Bbs10 Rat progesterone increases expression ISO BBS10 (Homo sapiens) 6480464 Progesterone results in increased expression of BBS10 mRNA CTD PMID:18070364 Bbs10 Rat rac-lactic acid decreases expression ISO BBS10 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BBS10 mRNA CTD PMID:30851411 Bbs10 Rat SB 431542 multiple interactions ISO BBS10 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BBS10 mRNA CTD PMID:27188386 Bbs10 Rat sodium arsenite decreases expression ISO BBS10 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BBS10 mRNA CTD PMID:38568856 Bbs10 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of BBS10 mRNA CTD PMID:30047161 Bbs10 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of BBS10 mRNA CTD PMID:34492290 Bbs10 Rat titanium dioxide increases expression ISO Bbs10 (Mus musculus) 6480464 titanium dioxide results in increased expression of BBS10 mRNA CTD PMID:35295148 Bbs10 Rat titanium dioxide increases methylation ISO Bbs10 (Mus musculus) 6480464 titanium dioxide results in increased methylation of BBS10 promoter CTD PMID:35295148 Bbs10 Rat titanium dioxide decreases methylation ISO Bbs10 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BBS10 gene CTD PMID:35295148 Bbs10 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of BBS10 mRNA CTD PMID:33387578 Bbs10 Rat trichostatin A decreases expression ISO BBS10 (Homo sapiens) 6480464 trichostatin A results in decreased expression of BBS10 mRNA CTD PMID:24935251 and PMID:26272509 Bbs10 Rat trichostatin A multiple interactions ISO BBS10 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BBS10 mRNA CTD PMID:27188386 Bbs10 Rat triphenyl phosphate affects expression ISO BBS10 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BBS10 mRNA CTD PMID:37042841 Bbs10 Rat triptonide increases expression ISO Bbs10 (Mus musculus) 6480464 triptonide results in increased expression of BBS10 mRNA CTD PMID:33045310 Bbs10 Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of BBS10 mRNA CTD PMID:36084822 Bbs10 Rat urethane decreases expression ISO BBS10 (Homo sapiens) 6480464 Urethane results in decreased expression of BBS10 mRNA CTD PMID:28818685 Bbs10 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of BBS10 mRNA CTD PMID:23034163 Bbs10 Rat zinc atom decreases expression ISO BBS10 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of BBS10 mRNA CTD PMID:22171008 Bbs10 Rat zinc(0) decreases expression ISO BBS10 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of BBS10 mRNA CTD PMID:22171008
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin M1 (ISO) amitrole (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) formaldehyde (ISO) furan (EXP,ISO) gentamycin (EXP) methimazole (EXP) Monobutylphthalate (EXP) paracetamol (EXP) phenobarbital (ISO) potassium chromate (ISO) progesterone (ISO) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) triticonazole (EXP) urethane (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
Biological Process
chaperone-mediated protein complex assembly (IBA,IEA,ISO) cone retinal bipolar cell differentiation (IEA,ISO) negative regulation of neuron apoptotic process (IEA,ISO) neuronal action potential (IEA,ISO) non-motile cilium assembly (IEA,ISO) photoreceptor cell differentiation (IEA,ISO) photoreceptor cell maintenance (IEA,ISO) protein localization (IEA,ISO) regulation of protein-containing complex assembly (IEA,ISO) response to endoplasmic reticulum stress (IEA,ISO) response to light stimulus (IEA,ISO) retina development in camera-type eye (IEA,ISO) retinal cone cell differentiation (IEA,ISO) retinal rod cell differentiation (IEA,ISO) visual perception (IEA,ISO)
Bbs10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 48,637,324 - 48,640,395 (+) NCBI GRCr8 mRatBN7.2 7 46,751,028 - 46,754,132 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 46,750,993 - 46,754,141 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 48,650,683 - 48,653,709 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 50,853,830 - 50,856,856 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 50,631,584 - 50,634,610 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 54,030,229 - 54,034,354 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 54,031,316 - 54,034,350 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 50,317,863 - 50,320,886 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 43,552,129 - 43,555,152 (+) NCBI Celera Cytogenetic Map 7 q22 NCBI
BBS10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 76,344,474 - 76,348,415 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 76,344,474 - 76,348,415 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 76,738,254 - 76,742,195 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 75,262,397 - 75,266,353 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 76,404,216 - 76,408,172 (-) NCBI Celera Cytogenetic Map 12 q21.2 NCBI HuRef 12 73,790,430 - 73,794,386 (-) NCBI HuRef CHM1_1 12 76,703,860 - 76,707,816 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 76,322,395 - 76,326,336 (-) NCBI T2T-CHM13v2.0
Bbs10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 111,134,540 - 111,137,597 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 111,134,540 - 111,137,588 (+) Ensembl GRCm39 Ensembl GRCm38 10 111,298,679 - 111,301,736 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 111,298,679 - 111,301,727 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 110,735,735 - 110,738,792 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 110,702,789 - 110,706,282 (+) NCBI MGSCv36 mm8 Celera 10 113,232,400 - 113,235,457 (+) NCBI Celera Cytogenetic Map 10 D1 NCBI cM Map 10 58.46 NCBI
Bbs10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 15,571,073 - 15,574,791 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 15,571,458 - 15,574,568 (-) NCBI ChiLan1.0 ChiLan1.0
BBS10 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 84,379,029 - 84,383,696 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 84,375,439 - 84,380,075 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 73,862,775 - 73,867,377 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 76,713,028 - 76,716,956 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 76,713,028 - 76,716,956 (-) Ensembl panpan1.1 panPan2
LOC100688777 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 19,302,988 - 19,334,763 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 19,331,876 - 19,335,583 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 19,788,066 - 19,819,690 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 19,646,036 - 19,657,550 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 15 19,243,010 - 19,274,520 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 19,304,566 - 19,316,044 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 19,432,535 - 19,444,024 (-) NCBI UU_Cfam_GSD_1.0
Bbs10 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 41,082,653 - 41,089,515 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936568 4,638,637 - 4,644,502 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936568 4,640,611 - 4,644,627 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BBS10 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 39,557,715 - 39,566,323 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 39,557,716 - 39,566,350 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 43,253,172 - 43,256,444 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BBS10 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 71,921,816 - 71,925,164 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 71,921,893 - 71,924,551 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 173,623,293 - 173,626,605 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bbs10
.
Predicted Target Of
Count of predictions: 43 Count of miRNA genes: 38 Interacting mature miRNAs: 41 Transcripts: ENSRNOT00000039096 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH130422
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 46,749,378 - 46,749,592 (+) MAPPER mRatBN7.2 Rnor_6.0 7 54,029,601 - 54,029,814 NCBI Rnor6.0 Rnor_5.0 7 54,167,511 - 54,167,724 UniSTS Rnor5.0 Rnor_5.0 7 54,039,365 - 54,039,578 UniSTS Rnor5.0 RGSC_v3.4 7 50,316,140 - 50,316,353 UniSTS RGSC3.4 Celera 7 43,550,406 - 43,550,619 UniSTS RH 3.4 Map 7 391.0 UniSTS Cytogenetic Map 7 q21 UniSTS
BE102942
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 46,753,892 - 46,754,079 (+) MAPPER mRatBN7.2 Rnor_6.0 7 54,034,115 - 54,034,301 NCBI Rnor6.0 Rnor_5.0 7 54,043,879 - 54,044,065 UniSTS Rnor5.0 RGSC_v3.4 7 50,320,654 - 50,320,840 UniSTS RGSC3.4 Celera 7 43,554,920 - 43,555,106 UniSTS RH 3.4 Map 7 390.1 UniSTS Cytogenetic Map 7 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039096 ⟹ ENSRNOP00000037320
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 46,750,993 - 46,754,141 (+) Ensembl Rnor_6.0 Ensembl 7 54,031,316 - 54,034,350 (+) Ensembl
RefSeq Acc Id:
NM_001109286 ⟹ NP_001102756
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,637,365 - 48,640,388 (+) NCBI mRatBN7.2 7 46,751,102 - 46,754,125 (+) NCBI Rnor_6.0 7 54,031,324 - 54,034,347 (+) NCBI Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI RGSC_v3.4 7 50,317,863 - 50,320,886 (+) RGD Celera 7 43,552,129 - 43,555,152 (+) RGD
Sequence:
CATCGGTCCTGACCTTCTAAAGAAGTATTTACCCACAGCTCCGTTTCCATGGCGTCCCAGGGGTCTGTGACAGCGGCACTGCGGGTGGCTGAGGTGCTGGAAACCATCGCGAACCGCTGCGTGGGGCC
hide sequence
RefSeq Acc Id:
XM_006241323 ⟹ XP_006241385
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 48,637,324 - 48,640,395 (+) NCBI mRatBN7.2 7 46,751,028 - 46,754,132 (+) NCBI Rnor_6.0 7 54,030,229 - 54,034,354 (+) NCBI Rnor_5.0 7 54,041,043 - 54,044,118 (+) NCBI
Sequence:
GTGTGTGTGTGAAAAAGATGGGTACAGGCCTGACACGGATTGTGACAGTATCCCTAATGTATGTTTTACTTGGTACTTCATATTCTTTTTTAAAAATAAGTGGAAATTATACCTATTTCATACATTAA
hide sequence
RefSeq Acc Id:
NP_001102756 ⟸ NM_001109286
- UniProtKB:
B1H296 (UniProtKB/TrEMBL)
- Sequence:
MASQGSVTAALRVAEVLETIANRCVGPEGGLVLCTKPTGEVLLSRDGGCLLEALHLEHPLARMIVACVSSHLKKTGDGAKTFIIFLCHLLRGLHAIGEKEKDSFTSEDIQSHERHWKNCCQWKSISRA
hide sequence
RefSeq Acc Id:
XP_006241385 ⟸ XM_006241323
- Peptide Label:
isoform X1
- UniProtKB:
F7EKF1 (UniProtKB/TrEMBL)
- Sequence:
MASQGSVTAALRVAEVLETIANRCVGPEGGLVLCTKPTGEVLLSRDGGCLLEALHLEHPLARGLHAIGEKEKDSFTSEDIQSHERHWKNCCQWKSISRALLRFQTQTLGCIVDQHLSRHYLSAFSSSA
hide sequence
Ensembl Acc Id:
ENSRNOP00000037320 ⟸ ENSRNOT00000039096
RGD ID: 13695189 Promoter ID: EPDNEW_R5714 Type: initiation region Name: Bbs10_1 Description: Bardet-Biedl syndrome 10 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 54,031,305 - 54,031,365 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-11-05
Bbs10
Bardet-Biedl syndrome 10
Bbs10
Bardet-Biedl syndrome 10 (human)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-28
Bbs10
Bardet-Biedl syndrome 10 (human)
RGD1560748_predicted
similar to hypothetical protein FLJ23560 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1560748_predicted
similar to hypothetical protein FLJ23560 (predicted)
LOC500832
similar to hypothetical protein FLJ23560
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC500832
similar to hypothetical protein FLJ23560
Symbol and Name status set to provisional
70820 PROVISIONAL
