Advanced Search (OLGA)

Gene: Ark2c (arkadia (RNF111) C-terminal like ring finger ubiquitin ligase 2C) Rattus norvegicus

Analyze

Symbol:

Ark2c

Name:

arkadia (RNF111) C-terminal like ring finger ubiquitin ligase 2C (Ensembl:arkadia C-terminal like ring finger ubiquitin ligase 2C)

RGD ID:

1560744

Description:

Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in motor neuron axon guidance and positive regulation of BMP signaling pathway. Predicted to act upstream of or within several processes, including forelimb morphogenesis; nervous system development; and protein polyubiquitination. Predicted to be part of protein-containing complex. Predicted to be active in nucleus. Orthologous to human ARK2C (arkadia (RNF111) C-terminal like ring finger ubiquitin ligase 2C); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,2',5,5'-tetrachlorobiphenyl; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

arkadia C-terminal like ring finger ubiquitin ligase 2C; E3 ubiquitin-protein ligase ARK2C; E3 ubiquitin-protein ligase RNF165; LOC307251; RGD1560744; ring finger protein 165; Rnf165; similar to ring finger protein 111

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	73,259,736 - 73,375,987 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	73,264,901 - 73,375,987 (-)	Ensembl				GRCr8
mRatBN7.2	18	70,984,566 - 71,100,836 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	70,989,731 - 71,100,836 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	73,092,683 - 73,203,942 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	73,761,890 - 73,873,212 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	71,618,481 - 71,729,797 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	73,831,289 - 73,873,246 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	73,831,326 - 73,873,280 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	73,505,861 - 73,553,844 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	74,413,654 - 74,530,319 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	69,510,509 - 69,538,262 (-)	NCBI		Celera
Cytogenetic Map	18	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

crocidolite asbestos (ISO)

decabromodiphenyl ether (EXP)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenvalerate (EXP)

furan (EXP)

genistein (ISO)

hydrogen peroxide (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

miconazole (ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

PCB138 (EXP,ISO)

perfluorononanoic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

sunitinib (ISO)

thiram (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axonogenesis (ISO)

forelimb morphogenesis (ISO)

innervation (ISO)

limb development (ISO)

motor neuron axon guidance (IBA,ISO)

muscle structure development (ISO)

positive regulation of BMP signaling pathway (IBA,ISO)

protein catabolic process (ISO)

protein polyubiquitination (ISO)

Cellular Component

nucleus (IBA,IEA,ISO)

protein-containing complex (IEA,ISO)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

transferase activity (IEA)

ubiquitin protein ligase activity (IBA,IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:23610558

Genomics

Comparative Map Data

Ark2c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	73,259,736 - 73,375,987 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	18	73,264,901 - 73,375,987 (-)	Ensembl				GRCr8
mRatBN7.2	18	70,984,566 - 71,100,836 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	70,989,731 - 71,100,836 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	73,092,683 - 73,203,942 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	73,761,890 - 73,873,212 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	71,618,481 - 71,729,797 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	73,831,289 - 73,873,246 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	73,831,326 - 73,873,280 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	73,505,861 - 73,553,844 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	74,413,654 - 74,530,319 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	69,510,509 - 69,538,262 (-)	NCBI		Celera
Cytogenetic Map	18	q12.3	NCBI

ARK2C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	46,334,018 - 46,463,140 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	46,326,809 - 46,463,140 (+)	Ensembl			hg38	GRCh38
GRCh37	18	43,913,981 - 44,043,103 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	42,168,185 - 42,294,781 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	18	42,160,770 - 42,294,335	NCBI
Celera	18	40,721,612 - 40,848,199 (+)	NCBI		Celera
Cytogenetic Map	18	q21.1	NCBI
HuRef	18	40,771,821 - 40,898,413 (+)	NCBI		HuRef
CHM1_1	18	43,841,208 - 43,967,794 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	46,524,603 - 46,653,701 (+)	NCBI		T2T-CHM13v2.0

Ark2c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	77,543,806 - 77,652,832 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	77,543,806 - 77,652,857 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	77,456,110 - 77,565,136 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	77,456,110 - 77,565,161 (-)	Ensembl			mm10	GRCm38
MGSCv37	18	77,694,849 - 77,803,875 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	77,660,560 - 77,770,607 (-)	NCBI		MGSCv36	mm8
Celera	18	78,639,714 - 78,748,970 (-)	NCBI		Celera
Cytogenetic Map	18	E3	NCBI
cM Map	18	52.28	NCBI

Ark2c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	31,867,645 - 31,969,804 (+)	Ensembl
ChiLan1.0	NW_004955402	31,867,651 - 31,975,930 (+)	NCBI	ChiLan1.0	ChiLan1.0

ARK2C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	63,758,604 - 63,885,385 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	49,451,202 - 49,577,986 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	39,615,759 - 39,742,492 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	43,246,884 - 43,274,212 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	43,244,066 - 43,274,212 (+)	Ensembl			panPan2	panpan1.1

ARK2C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	44,834,006 - 44,939,538 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	44,840,099 - 44,940,619 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	44,319,338 - 44,422,175 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	44,788,650 - 44,893,012 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	44,793,300 - 44,893,783 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	44,489,212 - 44,591,957 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	44,541,376 - 44,645,544 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	44,825,104 - 44,929,370 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ark2c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	41,095,644 - 41,203,958 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936517	429,292 - 531,361 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936517	428,689 - 531,360 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ARK2C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	95,950,746 - 96,066,928 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	95,951,387 - 96,072,522 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	106,267,178 - 106,280,496 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ARK2C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	34,446,996 - 34,573,186 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	34,451,095 - 34,474,080 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666050	8,818,570 - 8,945,258 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ark2c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624778	9,982,936 - 10,086,937 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624778	9,982,923 - 10,089,204 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ark2c
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	54,520,208 - 54,632,761 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ark2c
1210 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	638
Count of miRNA genes:	287
Interacting mature miRNAs:	371
Transcripts:	ENSRNOT00000075580
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	33379158	78379158	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	33379158	78379158	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	33379158	78379158	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	50795212	86134022	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	54490801	86134022	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31522783	76522783	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	33379158	78379158	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	62892257	79484461	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	33379158	78379158	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	64383762	79484311	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	33379158	78379158	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	38575919	83575919	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	57825243	85493247	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31610505	77371277	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	36121626	81121626	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	31990891	76990891	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	45620306	86134022	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	48915737	86134022	Rat
7794793	Mcs34	Mammary carcinoma susceptibility QTL 34	1.54		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	18	65635567	85897775	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31644508	79484311	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	48915737	86134022	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	48915737	86134022	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	65846447	86134022	Rat
1598832	Glom11	Glomerulus QTL 11	2.9		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	53266671	86134022	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31610505	77371277	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	31990891	76990891	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	31990891	76990891	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	45620306	86134022	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	50795212	86134022	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	61982204	76619168	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	62892257	79484461	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31610505	85493247	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	33379158	78379158	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	61446853	86134022	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	40462383	85462383	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	54490801	76272247	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	31990891	76990891	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat

Markers in Region

D18Rat121

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	18	73,295,098 - 73,295,326 (+)	Marker Load Pipeline
mRatBN7.2	18	71,019,930 - 71,020,158 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,875,703 - 73,875,930	NCBI	Rnor6.0
Rnor_5.0	18	73,556,301 - 73,556,528	UniSTS	Rnor5.0
RGSC_v3.4	18	74,449,015 - 74,449,242	RGD	RGSC3.4
RGSC_v3.4	18	74,449,016 - 74,449,243	UniSTS	RGSC3.4
Celera	18	69,540,719 - 69,540,946	UniSTS
RGSC_v3.1	18	74,522,288 - 74,522,515	RGD
SHRSP x BN Map	18	44.4299	UniSTS
SHRSP x BN Map	18	44.4299	RGD
Cytogenetic Map	18	q12.3	UniSTS

RH133453

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	71,003,142 - 71,003,323 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,858,604 - 73,858,784	NCBI	Rnor6.0
Rnor_6.0	18	73,844,734 - 73,844,914	NCBI	Rnor6.0
Rnor_5.0	18	73,537,294 - 73,537,474	UniSTS	Rnor5.0
Rnor_5.0	18	73,524,433 - 73,524,613	UniSTS	Rnor5.0
RGSC_v3.4	18	74,432,226 - 74,432,406	UniSTS	RGSC3.4
Celera	18	69,523,969 - 69,524,149	UniSTS
RH 3.4 Map	18	763.9	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

AI427432

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	70,984,763 - 70,984,911 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,826,360 - 73,826,507	NCBI	Rnor6.0
Rnor_5.0	18	73,506,059 - 73,506,206	UniSTS	Rnor5.0
RGSC_v3.4	18	74,413,852 - 74,413,999	UniSTS	RGSC3.4
Celera	18	69,505,564 - 69,505,711	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

RH135094

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	70,989,841 - 70,990,040 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,831,437 - 73,831,635	NCBI	Rnor6.0
Rnor_5.0	18	73,511,136 - 73,511,334	UniSTS	Rnor5.0
RGSC_v3.4	18	74,418,929 - 74,419,127	UniSTS	RGSC3.4
Celera	18	69,510,641 - 69,510,839	UniSTS
RH 3.4 Map	18	747.3	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

ha3141

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	71,052,263 - 71,052,471 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	73,908,022 - 73,908,229	NCBI	Rnor6.0
Rnor_5.0	18	73,588,620 - 73,588,827	UniSTS	Rnor5.0
RGSC_v3.4	18	74,481,140 - 74,481,347	UniSTS	RGSC3.4
Celera	18	69,572,211 - 69,572,418	UniSTS
Cytogenetic Map	18	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
10	3	50	155	50	39	26	11	26	6	183	88	8	129	58	86	13	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001164505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000075580 ⟹ ENSRNOP00000067322

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	73,264,901 - 73,375,987 (-)	Ensembl
mRatBN7.2 Ensembl	18	70,989,731 - 71,100,836 (-)	Ensembl
Rnor_6.0 Ensembl	18	73,831,326 - 73,873,280 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109402 ⟹ ENSRNOP00000081887

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	70,989,731 - 71,100,836 (-)	Ensembl

RefSeq Acc Id:

NM_001164505 ⟹ NP_001157977

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,264,880 - 73,375,987 (-)	NCBI
mRatBN7.2	18	70,989,710 - 71,100,836 (-)	NCBI
Rnor_6.0	18	73,831,289 - 73,873,246 (-)	NCBI
Rnor_5.0	18	73,505,861 - 73,553,844 (-)	NCBI
RGSC_v3.4	18	74,413,654 - 74,530,319 (-)	RGD
Celera	18	69,510,509 - 69,538,262 (-)	NCBI

Sequence:

show sequence

CGCGCGCAGCCGCCACCGCTGCGCGAGGAGCCAGGATGGTCCTGGTCCACGTCGGCTATCTCGT
GCTTCCAGTGTTTGGCTCTGTGCGAAACAGAGGTGCCCCCTTTCAAAGGTCTCAGCATCCTCAC
GCTACCTCCTGCCGCCACTTCCACCTGGGCCCCCCGCAGCCGCAGCAGCTAGCCCCGGACTTCC
CGCTGGCCCACCCCGTGCAGTCGCAGCCGGGCCTCAGCGCCCACATGGCCCCGGCCCACCAGCA
CAGTGGCACGCTGCACCAGTCGCTGACCCCGCTGCCCACCCTGCAGTTCCAGGACGTCACAGGT
CCCTCCTTCCTACCTCAGGCCCTGCACCAGCAATACCTGCTGCAGCAGCAGCTCCTGGAAGCTC
AGCACCGCAGGCTCGTCTCGCACCCCAGGCGGAGTCAGGATCGAGTGTCCGTCCACCCCCACCG
CCTTCACCCCAGCTTTGACTTCGGCCACCAACTGCAGACACCTCAGCCCCGGTATCTGGCTGAG
GGCACTGACTGGGATCTCAGTGTGGATGCCGCCAGCTTGAGTCCTGCCCAGTTCCAGGTGCGGC
CCATTCCTCAACACTATCAGCATTACCTAGCAACTCCTCGGATGCACCACTTCCCCAGAAACTC
CTCGTCCACACAGATGGTTGTCCATGAAATTCGAAACTACCCTTACCCCCAGCTTCATTTCCTC
GCCCTCCAGGGACTAAATCCTAGCCGGCACACCTCCGCAGTTCGGGAGAGCTATGAGGAGCTGC
TGCAGCTCGAGGACAGGCTGGGAAACGTGACCCGAGGAGCTGTACAGAACACCATTGAGAGGTT
CACCTTTCCCCACAAGTATAAGAAGCGAAGACCCCAGGACAGCAAGGGCAAGAAAGATGAAGGG
GAGGAGTCAGACACAGATGAGAAATGCACAATTTGTCTGTCTATGTTGGAGGACGGGGAAGATG
TGAGACGTCTACCGTGTATGCATCTCTTCCACCAACTGTGTGTGGACCAGTGGCTGGCCATGAG
CAAGAAGTGCCCCATCTGCCGAGTGGACATTGAGACACAGCTGGGAGCCGACAGCTGAGGGAGG
AGCTAGCCAGTGGACGCCCCATTTCCTTCACCAGGTCCCCCCCACGGCCATAGCCCTTGCAGCC
AAACTTTGCCTTCTGAGCCATTTGACGTAGAGAAGAAGCCTGCAAGCACATTTTGTGGAAAGAG
GAGTTGGTAGAGGTGTCTGAGGGAGAGGAGGGGTAGGGAGGACCCACCCATCCGGAATGGTGAC
TGCCTCATCGCCTTGCTGTGCAGCGGGGAGGGAGCTGGCCGTGCCCAGAGCAGGGGCGGGAAGG
GGGGGCCCGGCTGCTGAGGACTAGATGAGATGGCGATCGCGAGGGTACTAGCTGGTGATCGGCC
CCTCAGTCCTGTCCTTCGAGGGATTGTGTATATACCTCTTGACCACGTAGAAACCATGTAGGGG
TCTCTAGCTATTCTGTGGATGGCAGCCAGAGCATGTTAGCTTAAGAAAAATGTCGTGTGTGGTG
CTCTTGTCATCTGTGGTGGACATGTCGCTATTACTGAACTCGCACCAAATATTTCTCATTGAGT
TTCTTGTTTTGGTGCCTGACTGAACCAACCAACCAACGACAGCCCCAATCTTCCCGTCTTTATG
AGCGAAAAGAAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039096778 ⟹ XP_038952706

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	73,259,736 - 73,304,231 (-)	NCBI
mRatBN7.2	18	70,984,566 - 71,029,075 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001157977	(Get FASTA)	NCBI Sequence Viewer
	XP_038952706	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66566	(Get FASTA)	NCBI Sequence Viewer
	EDL84711	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067322
	ENSRNOP00000067322.2

RefSeq Acc Id:

NP_001157977 ⟸ NM_001164505

- UniProtKB:

B2GV81 (UniProtKB/TrEMBL), M0RCK2 (UniProtKB/TrEMBL), A0A8I5ZSL4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAPDFPLAHPVQSQPGL
SAHMAPAHQHSGTLHQSLTPLPTLQFQDVTGPSFLPQALHQQYLLQQQLLEAQHRRLVSHPRRS
QDRVSVHPHRLHPSFDFGHQLQTPQPRYLAEGTDWDLSVDAASLSPAQFQVRPIPQHYQHYLAT
PRMHHFPRNSSSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLGNVTR
GAVQNTIERFTFPHKYKKRRPQDSKGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQ
LCVDQWLAMSKKCPICRVDIETQLGADS

hide sequence

Ensembl Acc Id:

ENSRNOP00000067322 ⟸ ENSRNOT00000075580

RefSeq Acc Id:	XP_038952706 ⟸ XM_039096778
- Peptide Label:	isoform X1
- UniProtKB:	A6KMV1 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000081887 ⟸ ENSRNOT00000109402

Protein Domains

RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RCK2-F1-model_v2	AlphaFold	M0RCK2	1-340	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560744	AgrOrtholog
BioCyc Gene	G2FUF-6940	BioCyc
Ensembl Genes	ENSRNOG00000048824	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000075580	ENTREZGENE
	ENSRNOT00000075580.4	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7317237	IMAGE-MGC_LOAD
InterPro	MBR1/2-like	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING-CH	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
KEGG Report	rno:307251	UniProtKB/TrEMBL
MGC_CLONE	MGC:188196	IMAGE-MGC_LOAD
NCBI Gene	307251	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE RNF165	UniProtKB/TrEMBL
	E3 UBIQUITIN-PROTEIN LIGASE RNF165	UniProtKB/TrEMBL
Pfam	zf-RING_2	UniProtKB/TrEMBL
PhenoGen	Ark2c	PhenoGen
PROSITE	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000048824	RatGTEx
SMART	RING	UniProtKB/TrEMBL
	RINGv	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
UniProt	A0A8I5ZSL4	ENTREZGENE
	A6KMV1	ENTREZGENE, UniProtKB/TrEMBL
	B2GV81	ENTREZGENE, UniProtKB/TrEMBL
	M0RCK2	ENTREZGENE
UniProt Secondary	M0RCK2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-04-28	Ark2c	arkadia (RNF111) C-terminal like ring finger ubiquitin ligase 2C	Ark2c	arkadia C-terminal like ring finger ubiquitin ligase 2C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2023-04-18	Ark2c	arkadia C-terminal like ring finger ubiquitin ligase 2C	Rnf165	ring finger protein 165	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-28	Rnf165	ring finger protein 165	RGD1560744_predicted	similar to ring finger protein 111 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560744_predicted	similar to ring finger protein 111 (predicted)	LOC307251	similar to ring finger protein 111	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC307251	similar to ring finger protein 111			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message