Advanced Search (OLGA)

Gene: Fezf1 (Fez family zinc finger 1) Rattus norvegicus

Analyze

Symbol:

Fezf1

Name:

Fez family zinc finger 1

RGD ID:

1560480

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including cell dedifferentiation; regulation of DNA-templated transcription; and regulation of neurogenesis. Predicted to act upstream of or within nervous system development and positive regulation of neuron differentiation. Predicted to be located in cytosol and nucleoplasm. Human ortholog(s) of this gene implicated in hypogonadotropic hypogonadism 22 with or without anosmia. Orthologous to human FEZF1 (FEZ family zinc finger 1); INTERACTS WITH 1,2-dimethylhydrazine; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Fez family zinc finger protein 1; LOC500048; RGD1560480; similar to zinc finger protein 312; zinc finger protein 312B

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FEZF1 (FEZ family zinc finger 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fezf1 (Fez family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fezf1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FEZF1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FEZF1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fezf1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FEZF1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FEZF1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fezf1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Fezf1 (FEZ family zinc finger 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ATMIN (ATM interactor)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Fezf1 (Fez family zinc finger 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FEZF1 (FEZ family zinc finger 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fezf1 (FEZ family zinc finger 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fezf-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	erm	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	erm	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fezf1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	52,728,385 - 52,733,315 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	52,728,391 - 52,731,718 (-)	Ensembl				GRCr8
mRatBN7.2	4	51,762,751 - 51,766,078 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	51,762,751 - 51,766,078 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	56,736,924 - 56,740,292 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	52,657,956 - 52,661,324 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	51,098,883 - 51,102,210 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	50,309,281 - 50,312,608 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	50,309,281 - 50,312,608 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	50,092,049 - 50,095,376 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	49,641,144 - 49,644,471 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	46,957,155 - 46,960,482 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amenorrhea (ISO)

genetic disease (ISO)

hypogonadotropic hypogonadism 22 with or without anosmia (ISO)

hypogonadotropic hypogonadism 7 with or without anosmia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cyclosporin A (ISO)

diethylstilbestrol (EXP)

ethylparaben (ISO)

folic acid (ISO)

iron dichloride (ISO)

ketoconazole (EXP)

okadaic acid (ISO)

resveratrol (ISO)

titanium dioxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon guidance (ISO)

cell dedifferentiation (IEA,ISO)

cell differentiation (IEA)

DNA-templated transcription (IEA)

forebrain anterior/posterior pattern specification (IEA,ISO)

forebrain development (ISO)

interneuron migration (IEA)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

nervous system development (IEA)

neuron migration (ISO)

olfactory bulb development (ISO)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of neuron differentiation (IEA,ISO)

regulation of neurogenesis (IEA,ISO)

regulation of transcription by RNA polymerase II (IBA)

telencephalon development (IEA,ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IEA)

Molecular Function

DNA binding (IEA)

DNA-binding transcription factor activity (IBA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO)

metal ion binding (IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

transcription cis-regulatory region binding (IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16540508	PMID:16971467	PMID:20152183	PMID:20431123	PMID:28245922

Genomics

Comparative Map Data

Fezf1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	52,728,385 - 52,733,315 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	52,728,391 - 52,731,718 (-)	Ensembl				GRCr8
mRatBN7.2	4	51,762,751 - 51,766,078 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	51,762,751 - 51,766,078 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	56,736,924 - 56,740,292 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	52,657,956 - 52,661,324 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	51,098,883 - 51,102,210 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	50,309,281 - 50,312,608 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	50,309,281 - 50,312,608 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	50,092,049 - 50,095,376 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	49,641,144 - 49,644,471 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	46,957,155 - 46,960,482 (-)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

FEZF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	122,301,303 - 122,310,723 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	122,301,303 - 122,310,691 (-)	Ensembl			hg38	GRCh38
GRCh37	7	121,941,357 - 121,944,804 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	121,729,287 - 121,731,835 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	7	116,745,770 - 116,748,887 (-)	NCBI		Celera
Cytogenetic Map	7	q31.32	NCBI
HuRef	7	116,304,856 - 116,307,947 (-)	NCBI		HuRef
CHM1_1	7	121,874,824 - 121,877,944 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	123,617,261 - 123,627,513 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	121,336,131 - 121,339,251 (-)	NCBI

Fezf1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	23,245,043 - 23,250,942 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	23,245,043 - 23,248,361 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	23,245,044 - 23,250,936 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	23,245,044 - 23,248,362 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	23,195,047 - 23,198,264 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	23,195,048 - 23,198,363 (-)	NCBI		MGSCv36	mm8
Celera	6	23,288,549 - 23,291,766 (-)	NCBI		Celera
Cytogenetic Map	6	A3.1	NCBI
cM Map	6	10.55	NCBI

Fezf1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	3,945,292 - 3,951,847 (-)	Ensembl
ChiLan1.0	NW_004955479	3,945,358 - 3,953,924 (-)	NCBI	ChiLan1.0	ChiLan1.0

FEZF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	159,172,441 - 159,183,332 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	11,182,695 - 11,193,565 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	114,311,563 - 114,322,490 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	126,995,708 - 127,005,733 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	126,995,708 - 127,005,732 (-)	Ensembl			panPan2	panpan1.1

FEZF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	14	59,516,294 - 59,519,740 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	60,134,017 - 60,137,791 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	14	60,225,153 - 60,228,448 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	59,853,061 - 59,856,359 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	60,230,290 - 60,233,738 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fezf1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	49,173,482 - 49,183,525 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936605	3,027,122 - 3,030,449 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936605	3,027,138 - 3,030,442 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FEZF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	24,879,031 - 24,884,917 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	24,881,850 - 24,884,790 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	26,477,369 - 26,481,974 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FEZF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	91,099,660 - 91,110,242 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	91,100,346 - 91,102,767 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	12,434,235 - 12,444,298 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fezf1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	13,713,422 - 13,718,604 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624783	13,715,987 - 13,719,287 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fezf1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	115,991,547 - 115,994,854 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fezf1
32 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	78
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000010019
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	13080146	58080146	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	35113290	80113290	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	41400577	86400577	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	44425024	89425024	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	40490442	75726188	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
10450825	Scl78	Serum cholesterol level QTL 78	3.7	0.01	blood VLDL cholesterol amount (VT:0005144)	blood low density lipoprotein cholesterol level (CMO:0000053)	4	50143926	58080146	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
10450821	Scl77	Serum cholesterol level QTL 77	4.1	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	50143926	58080146	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	37269577	82269577	Rat
10450818	Scl76	Serum cholesterol level QTL 76	3.6	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	50143926	58080146	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	40471453	75939996	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	41400603	86400603	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	27862204	62997402	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	41400577	86400577	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	33538816	53719714	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat

Markers in Region

AI722599

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	51,763,669 - 51,764,294 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	50,310,200 - 50,310,824	NCBI	Rnor6.0
Rnor_5.0	4	50,092,968 - 50,093,592	UniSTS	Rnor5.0
RGSC_v3.4	4	49,642,063 - 49,642,687	UniSTS	RGSC3.4
Celera	4	46,958,074 - 46,958,698	UniSTS
Cytogenetic Map	4	q22	UniSTS

Fezf1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	51,765,737 - 51,765,802 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	50,312,268 - 50,312,332	NCBI	Rnor6.0
Rnor_5.0	4	50,095,036 - 50,095,100	UniSTS	Rnor5.0
RGSC_v3.4	4	49,644,131 - 49,644,195	UniSTS	RGSC3.4
Celera	4	46,960,142 - 46,960,206	UniSTS
Cytogenetic Map	4	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
5	78	12	7	4	3	4	18	7	75	2	15	3	5	5

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286480	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010019 ⟹ ENSRNOP00000010019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	52,728,391 - 52,731,718 (-)	Ensembl
mRatBN7.2 Ensembl	4	51,762,751 - 51,766,078 (-)	Ensembl
Rnor_6.0 Ensembl	4	50,309,281 - 50,312,608 (-)	Ensembl

RefSeq Acc Id:

NM_001109224 ⟹ NP_001102694

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	52,728,391 - 52,731,718 (-)	NCBI
mRatBN7.2	4	51,762,751 - 51,766,078 (-)	NCBI
Rnor_6.0	4	50,309,281 - 50,312,608 (-)	NCBI
Rnor_5.0	4	50,092,049 - 50,095,376 (-)	NCBI
RGSC_v3.4	4	49,641,144 - 49,644,471 (-)	RGD
Celera	4	46,957,155 - 46,960,482 (-)	RGD

Sequence:

show sequence

GGAAGTTAACGATTGGCGAGATCTTGGCTGCGTTATTGACACAACACTTTCTATTGATAGAAAT
AAGTAGTGATTGTCCCCGAGTCATTGGTGCGCCAAGAACTCTGCGATGGGCTGGCAGGAGTCCA
TTGGGCTGGGCAGGCAGGTTCGGCTGGTGATGCTGGGGAGGAGGAGGAGGAGGCTGCTGGTGGT
GACGGTGCCTGTCCTCTCCGCAGGTCTGTGACAAGCAGGGGACAAGGCAACGATCGTGCGACTC
AACCCCGGCGGACCGACGCTGGCGACTCAGTCATGGACAGTAGCTGCCTCAACGCGACCACCAA
AATGCTAGCGACTGCTCCAGCTCGGGGCAACGTGATGAGCACATCCAAACCCTTGGCTTTCTCC
ATCGAACGAATCATGGCGCGCACCCCTGAGCCTAAGGCCCTGCCGGTCCCCCACTTCCTGCAGG
GAGCCGTGCCCAAAGGGGACCCCAAGCACTCTCTGCATCTCAACTCGTCGATCCCCTGCATGAT
CCCTTTCGTTCCCGTGGCGTACGACACGAACTCCAAAGCAGGAGTGAATGGCTCAGAGCCCCGC
AAAGCGAGTTTGGAGGTTCCGGCGCCGCCCGCGGTGGCGCCCTCCGCGCCCGCGTTCAGCTGCA
GCGACCTGCTCAACTGCGCTCTAAGTCTCAAGGGCGACCTGGCCCGCGACGCGCTGCCACTACA
GCAGTACAAGCTGGTAAGGCCGCGTGTGGTGAACCACTCTTCGTTCCACGCCATGGGCGCCCTG
TGCTACCTGAACCGAGGTGACGGCCCGTGCCACCCGGCTGCGGGCGTGAACATCCACCCCGTGG
CCTCCTACTTTCTCAGTTCCCCTTTGCACCCACAGCCCAAAACATATTTAGCCGAAAGGAATAA
ACTGGTCGTCCCGGCGGTGGAGAAGCTACCTTCGGGAGTAGCTTTCAAAGACCTGTCCCAGGCT
CAGCTACACAATTACATGAAAGAAAGCGCCCAACTTTTGTCGGAAAAAATCGCTTTCAAAACCT
CGGATTTCAGCCGCGGCTCTCCTAACGCCAAACCCAAAGTTTTCACTTGCGAAGTCTGCGGAAA
GGTCTTTAATGCGCACTATAACTTAACCCGTCACATGCCGGTGCACACAGGAGCCAGACCCTTC
GTGTGCAAAGTGTGTGGGAAAGGTTTCCGGCAAGCCAGCACCCTTTGCCGGCATAAGATCATTC
ACACACAGGAAAAACCCCACAAATGCAACCAGTGCGGGAAAGCGTTTAATAGAAGTTCCACGTT
AAACACACACACCCGAATTCACGCGGGCTACAAACCATTCGTGTGTGAATTCTGTGGCAAAGGA
TTTCATCAAAAAGGGAATTACAAAAATCACAAGCTGACCCACAGCGGGGAGAAGCAGTTCAAGT
GCAATATCTGCAACAAGGCTTTCCACCAGGTGTACAACCTCACCTTCCACATGCACACTCACAA
CGACAAGAAGCCTTTCACTTGCCCCACGTGTGGCAAGGGCTTCTGTAGGAACTTTGACCTCAAG
AAGCATGTCCGCAAGCTACACGACAGCAGCCTGGGGCTGACCCGCACTCCTACTGGGGAGCCAG
GCAGCGATCCGCCGCCCCAGCTGCAACAGCCGCCGCCCGCGCCTCTGCCGCCGCTGCAACCTAC
CTTGCCGCCTCCCGGGCCTCTGCAATCCGGGCTTCACCAAGGCCACCAGTGACGGAGGCTAAAG
ATCTCCCTAACCCCAACCGGAGGGCCCTCACTGCGGAAGTCCGCAGACTAGAGCGGACCTCTTG
GTCCAAGCTCGCCTACAAAACCCGGGGCACCGGGCGCAAAAGGGCCCCGCACTTTCGGGAGGAC
CCCATGCCTCTACATCCCTTGGCCTTTCGCCTCTTGCATGCACCTGCTAAATGGTTTTGTGTAT
TATATTCTATATAGGCACTAACAATTACGATATATTTGGAGGGACTTATTTCAATTTTTTTTTG
AGTTGAGAAGACTTTTCATCTCGGGTGGAGAGATGGTGTTTGTTTTGTTTTGTTTTTAAACGAA
TATCTGCTGTATTTATTGAGATCTGTATTATTCTACCCGGGAATGCTGCATCATTTTAATTTTA
TTATTGTATATATTTCCATTGTGTCGATTCTGCCATCTCAAAATGCCTGCTGACCGTTTATAAT
TTTCTCCTTCCCCGAAGCAACAAAACGCGGTGTGTATGTTCTATATACACACAGAGGTGTGTAC
TTGTGAGGATGCGTTCACCATTTGTGAGCCCATACATAACACACACACATACATATTAGATAAG
AGTGGCTCATTACGAATGAATTTCAAATTTTGCTTTTGATCCTTGCACGTCGGAGTTGATTCAT
TGACTGTTGGAAATAAAAACTTGGAACATGCTTATTTAATC

hide sequence

RefSeq Acc Id:

XM_063286480 ⟹ XP_063142550

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	52,728,385 - 52,733,315 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102694	(Get FASTA)	NCBI Sequence Viewer
	XP_063142550	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM15160	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010019
	ENSRNOP00000010019.4

RefSeq Acc Id:

NP_001102694 ⟸ NM_001109224

- UniProtKB:

D3ZPD6 (UniProtKB/TrEMBL), A6IE73 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDSSCLNATTKMLATAPARGNVMSTSKPLAFSIERIMARTPEPKALPVPHFLQGAVPKGDPKHS
LHLNSSIPCMIPFVPVAYDTNSKAGVNGSEPRKASLEVPAPPAVAPSAPAFSCSDLLNCALSLK
GDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHPVASYFLSSPLHP
QPKTYLAERNKLVVPAVEKLPSGVAFKDLSQAQLHNYMKESAQLLSEKIAFKTSDFSRGSPNAK
PKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQ
CGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQV
YNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSSLGLTRTPTGEPGSDPPPQLQQP
PPAPLPPLQPTLPPPGPLQSGLHQGHQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000010019 ⟸ ENSRNOT00000010019

RefSeq Acc Id:	XP_063142550 ⟸ XM_063286480
- Peptide Label:	isoform X1
- UniProtKB:	A6IE73 (UniProtKB/TrEMBL), D3ZPD6 (UniProtKB/TrEMBL)

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZPD6-F1-model_v2	AlphaFold	D3ZPD6	1-475	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560480	AgrOrtholog
BioCyc Gene	G2FUF-45497	BioCyc
Ensembl Genes	ENSRNOG00000007608	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010019	ENTREZGENE
	ENSRNOT00000010019.6	UniProtKB/TrEMBL
Gene3D-CATH	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	Znf_C2H2/integrase_DNA-bd	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
KEGG Report	rno:500048	UniProtKB/TrEMBL
NCBI Gene	500048	ENTREZGENE
PANTHER	ZINC FINGER PROTEIN	UniProtKB/TrEMBL
	ZINC FINGER PROTEIN 771	UniProtKB/TrEMBL
Pfam	zf-C2H2	UniProtKB/TrEMBL
	zf-C2H2_6	UniProtKB/TrEMBL
PhenoGen	Fezf1	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007608	RatGTEx
SMART	ZnF_C2H2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57667	UniProtKB/TrEMBL
UniProt	A6IE73	ENTREZGENE, UniProtKB/TrEMBL
	D3ZPD6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-28	Fezf1	Fez family zinc finger 1	RGD1560480_predicted	similar to zinc finger protein 312 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560480_predicted	similar to zinc finger protein 312 (predicted)	LOC500048	similar to zinc finger protein 312	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500048	similar to zinc finger protein 312			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM