Rnd3 (Rho family GTPase 3) - Rat Genome Database

Name: Rnd3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Rnd3 (Rho family GTPase 3) Rattus norvegicus

Analyze

Symbol:

Rnd3

Name:

Rho family GTPase 3

RGD ID:

1359690

Description:

Predicted to enable GTP binding activity; GTPase activity; and protein kinase binding activity. Predicted to be involved in several processes, including actin filament organization; cell migration; and regulation of actin cytoskeleton organization. Predicted to be active in cytosol and plasma membrane. Orthologous to human RND3 (Rho family GTPase 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Arhe; ras homolog gene family, member E; rho-related GTP-binding protein RhoE; RHOE

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RND3 (Rho family GTPase 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rnd3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rnd3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RND3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RND3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rnd3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RND3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RND3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rnd3 (Rho family GTPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SECISBP2 (SECIS binding protein 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RND3 (Rho family GTPase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rnd3 (Rho family GTPase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rnd3b (Rho family GTPase 3b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	rnd3a (Rho family GTPase 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RHO3	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	RHO4	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	rnd3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	55,981,142 - 55,998,494 (-)	NCBI		GRCr8
mRatBN7.2	3	35,571,929 - 35,589,283 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	35,571,143 - 35,589,327 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	38,969,914 - 38,987,277 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	47,554,663 - 47,572,026 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	45,332,304 - 45,350,239 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	36,643,374 - 36,660,727 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	36,642,587 - 36,660,758 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	41,757,186 - 41,774,539 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	32,101,433 - 32,118,785 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	31,997,804 - 32,015,157 (-)	NCBI
Celera	3	33,730,327 - 33,747,679 (-)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hepatocellular carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-vinylcyclohexene dioxide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amphetamine (EXP)

amphotericin B (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

azoxystrobin (EXP)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

butan-1-ol (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroacetaldehyde (ISO)

chloropicrin (ISO)

chloroprene (ISO)

chlorpromazine (EXP)

chlorpyrifos (EXP)

cidofovir anhydrous (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clodronic acid (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (EXP,ISO)

cylindrospermopsin (ISO)

cyproconazole (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dibutyl phthalate (EXP,ISO)

dieldrin (EXP)

dimethylarsinous acid (ISO)

dioxygen (ISO)

diquat (ISO)

dorsomorphin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenofibrate (EXP)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glycidol (EXP)

glyphosate (EXP)

imidacloprid (EXP)

isotretinoin (ISO)

ketamine (EXP)

lead(0) (ISO)

lithium chloride (ISO)

mercury dibromide (ISO)

mercury dichloride (EXP)

metformin (EXP)

methapyrilene (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

mono(2-ethylhexyl) phthalate (EXP)

nickel dichloride (EXP)

nicotine (ISO)

oxaliplatin (EXP)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

pirinixic acid (ISO)

piroxicam (ISO)

progesterone (ISO)

quinomethionate (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

SL-327 (ISO)

sodium arsenite (ISO)

Soman (EXP)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloro-1,4-benzoquinone (ISO)

tetrachloromethane (ISO)

thiabendazole (EXP)

thioacetamide (EXP)

topotecan (EXP)

trichostatin A (ISO)

troglitazone (EXP)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

vorinostat (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin filament organization (IBA)

cell migration (IBA)

regulation of actin cytoskeleton organization (IBA)

signal transduction (IBA)

small GTPase-mediated signal transduction (IEA)

Cellular Component

cytosol (IBA,IEA)

plasma membrane (IBA)

Molecular Function

GTP binding (IBA,IEA)

GTPase activity (IBA,IEA)

protein binding (ISO)

protein kinase binding (IBA,IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	RhoE binds to ROCK I and inhibits downstream signaling.	Riento K, etal., Mol Cell Biol. 2003 Jun;23(12):4219-29.
6.	RhoE inhibits cell cycle progression and Ras-induced transformation.	Villalonga P, etal., Mol Cell Biol 2004 Sep;24(18):7829-40.

Additional References at PubMed

PMID:12477932	PMID:14732713	PMID:16311049	PMID:21423176	PMID:23376485	PMID:23762244	PMID:32705255

Genomics

Comparative Map Data

Rnd3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	55,981,142 - 55,998,494 (-)	NCBI		GRCr8
mRatBN7.2	3	35,571,929 - 35,589,283 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	35,571,143 - 35,589,327 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	38,969,914 - 38,987,277 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	47,554,663 - 47,572,026 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	45,332,304 - 45,350,239 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	36,643,374 - 36,660,727 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	36,642,587 - 36,660,758 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	41,757,186 - 41,774,539 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	32,101,433 - 32,118,785 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	31,997,804 - 32,015,157 (-)	NCBI
Celera	3	33,730,327 - 33,747,679 (-)	NCBI		Celera
Cytogenetic Map	3	q12	NCBI

RND3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	150,468,193 - 150,487,695 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	150,468,195 - 150,539,011 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	151,324,707 - 151,344,209 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	151,032,955 - 151,052,426 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	151,150,216 - 151,169,688	NCBI
Celera	2	144,938,960 - 144,958,449 (-)	NCBI		Celera
Cytogenetic Map	2	q23.3	NCBI
HuRef	2	143,221,253 - 143,240,784 (-)	NCBI		HuRef
CHM1_1	2	151,330,489 - 151,349,997 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	150,918,573 - 150,938,077 (-)	NCBI		T2T-CHM13v2.0

Rnd3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	51,020,451 - 51,039,123 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	51,020,450 - 51,039,123 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	51,130,439 - 51,149,111 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	51,130,438 - 51,149,111 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	50,985,959 - 51,004,631 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	50,952,448 - 50,971,120 (-)	NCBI		MGSCv36	mm8
Celera	2	52,814,575 - 52,833,308 (-)	NCBI		Celera
Cytogenetic Map	2	C1.1	NCBI
cM Map	2	29.63	NCBI

Rnd3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955440	16,106,555 - 16,113,337 (-)	NCBI	ChiLan1.0	ChiLan1.0

RND3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	24,453,723 - 24,473,246 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	24,468,716 - 24,488,201 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	9,387,338 - 9,406,785 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	154,813,235 - 154,832,768 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	154,810,039 - 154,832,768 (-)	Ensembl	panpan1.1		panPan2

RND3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	19	51,889,693 - 51,909,028 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	19	51,891,494 - 51,909,033 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	19	52,002,669 - 52,022,012 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	19	53,352,354 - 53,372,496 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	19	53,352,356 - 53,373,467 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	19	52,048,081 - 52,066,346 (-)	NCBI		UMICH_Zoey_3.1
UMICH_Zoey_3.1	19	52,034,519 - 52,038,409 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	19	52,130,759 - 52,149,808 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	19	53,545,000 - 53,564,447 (-)	NCBI		UU_Cfam_GSD_1.0

Rnd3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	114,618,761 - 114,636,348 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	26,981,318 - 27,000,739 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	26,981,358 - 26,998,902 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RND3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	1,715,207 - 1,734,414 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	1,715,589 - 1,732,605 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	999,583 - 1,008,986 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RND3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	35,877,147 - 35,897,318 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	35,877,153 - 35,897,286 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	163,652,947 - 163,672,492 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rnd3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624866	3,345,774 - 3,364,345 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624866	3,346,747 - 3,363,962 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rnd3
95 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	326
Count of miRNA genes:	178
Interacting mature miRNAs:	236
Transcripts:	ENSRNOT00000006111
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	3	10778704	50302886	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	47233430	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	18311454	47233430	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	18311454	47233430	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	18311454	47233430	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	18311454	47233430	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	18311454	47233430	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	18311454	47233430	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
1298073	Cm13	Cardiac mass QTL 13	2.5		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	25013911	38192233	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	27494621	44188411	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	27494621	50302886	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	27494621	50302886	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	27494621	50302886	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	27494621	50302886	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat

Markers in Region

RH143020

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	35,572,114 - 35,572,385 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	36,643,560 - 36,643,830	NCBI	Rnor6.0
Rnor_5.0	3	41,757,372 - 41,757,642	UniSTS	Rnor5.0
RGSC_v3.4	3	32,101,619 - 32,101,889	UniSTS	RGSC3.4
Celera	3	33,730,513 - 33,730,783	UniSTS
RH 3.4 Map	3	426.2	UniSTS
Cytogenetic Map	3	q12	UniSTS

RH128302

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	35,571,348 - 35,571,546 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	36,642,794 - 36,642,991	NCBI	Rnor6.0
Rnor_5.0	3	41,756,606 - 41,756,803	UniSTS	Rnor5.0
RGSC_v3.4	3	32,100,853 - 32,101,050	UniSTS	RGSC3.4
Celera	3	33,729,747 - 33,729,944	UniSTS
RH 3.4 Map	3	421.9	UniSTS
Cytogenetic Map	3	q12	UniSTS

RH142874

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	35,578,739 - 35,578,889 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	36,650,185 - 36,650,334	NCBI	Rnor6.0
Rnor_5.0	3	41,763,997 - 41,764,146	UniSTS	Rnor5.0
RGSC_v3.4	3	32,108,244 - 32,108,393	UniSTS	RGSC3.4
Celera	3	33,737,138 - 33,737,287	UniSTS
Cytogenetic Map	3	q12	UniSTS

RH139131

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	35,578,606 - 35,578,728 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	36,650,052 - 36,650,173	NCBI	Rnor6.0
Rnor_5.0	3	41,763,864 - 41,763,985	UniSTS	Rnor5.0
RGSC_v3.4	3	32,108,111 - 32,108,232	UniSTS	RGSC3.4
Celera	3	33,737,005 - 33,737,126	UniSTS
RH 3.4 Map	3	429.0	UniSTS
Cytogenetic Map	3	q12	UniSTS

RH140139

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	3	445.9	UniSTS
Cytogenetic Map	3	q12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	33	56	41	17	41	4	4	70	35	34	11	4
Low		10	1		2		4	7	4		7		4
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY461427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000006111 ⟹ ENSRNOP00000006111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	35,571,143 - 35,589,327 (-)	Ensembl
Rnor_6.0 Ensembl	3	36,642,587 - 36,660,758 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095476 ⟹ ENSRNOP00000079889

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	35,574,679 - 35,589,327 (-)	Ensembl

RefSeq Acc Id:

NM_001007641 ⟹ NP_001007642

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	55,981,142 - 55,998,494 (-)	NCBI
mRatBN7.2	3	35,571,929 - 35,589,283 (-)	NCBI
Rnor_6.0	3	36,643,374 - 36,660,727 (-)	NCBI
Rnor_5.0	3	41,757,186 - 41,774,539 (-)	NCBI
RGSC_v3.4	3	32,101,433 - 32,118,785 (-)	RGD
Celera	3	33,730,327 - 33,747,679 (-)	RGD

Sequence:

show sequence

AGGGGCAGAAAACTTGTAGGAGAGGAGTAAAGAGCCGCTGCCTCTCCTCCTCCAACTCCGCTGC
GCTTAAGGGGTTCCCTCCGGCCTTGCGATTTATTTTTATATCCGCTTTTTATAGAGAGAAGTAT
ATATATTTTTTTCTTCTAAAGAGAAAAATTCCTGTTCCAAGAGAAAATAAGGCAACATCAATGA
AGGAGAGAAGAGCCAGCCAGAAATTATCCAGTAAATCTATCATGGATCCTAATCAGAACGTGAA
ATGCAAGATAGTAGTGGTGGGCGACAGCCAGTGTGGGAAAACCGCGCTGCTCCACGTCTTCGCA
AAGGACTGCTTCCCCGAAAATTACGTCCCTACGGTGTTTGAGAATTACACTGCCAGTTTTGAAA
TCGACACACAAAGAATAGAGTTGAGCCTGTGGGACACTTCAGGTTCCCCTTACTATGACAACGT
CCGTCCCCTCTCTTACCCAGATTCTGATGCTGTGCTCATTTGCTTTGACATCAGTAGACCAGAA
ACTCTGGACAGTGTCTTAAAGAAGTGGAAAGGTGAAATCCAGGAGTTTTGTCCCAATACCAAGA
TGCTGTTGGTTGGTTGCAAGTCTGACCTTCGGACAGATGTCAGCACACTAGTGGAACTCTCAAA
TCACAGGCAGACTCCTGTGTCATATGATCAGGGGGCAAACATGGCGAAGCAGATCGGAGCAGCC
ACTTACATAGAATGCTCAGCTTTACAGTCGGAGAACAGCGTCAGAGACATTTTTCACGTCGCCA
CCTTGGCGTGTGTAAATAAGACAAATAAAAACGTTAAGCGGAACAAATCACAGAGGGCCACAAA
GCGGATTTCACACATGCCTAGCAGACCAGAACTCTCAGCAGTTGCTACGGACTTACGAAAGGAC
AAAGCCAAGAGCTGCACTGTGATGTGAGGCTTCACCGTCTTTAATGAGGACACATGGAAATCTG
GTGTAAAAAAAAATTAAAATAAAATTTGAAACAGCAAGAGCAAACGGAAAGAGGGAGTCAAATG
AAGTGCACAGCCAAAGTCACATGGACACAAGGCGTAGGAGTCCCTTGAAAAAAAAAGTGGATAC
CCACTTTTCGGAATCCTGTCCTTAGTTTCGGCATGTAGACCGAGTGGTGAGAAGCGAATGCGTT
GAAGAGTTTTGTGTAACAAGAGGTGTGACTTGAAAAATACACCAAAAACAAAGGGAGCTACAAA
CGGGCGAGCGCTAGAGAAGTGGGGGGCCCTGGTACCTCCAAGAAAAAAGTCCACGCTTTGAATG
GTGCTTGAGTATTTTTGGTTTTGTGTTTGNGGTTTTATTACAACCTATTCGTGGATCTCTACTT
TGATTTAGTTTTTCAATGTTTTAATCCCTTTTTCCAAAAAAGTATATATTAGTAGACCGTCCTC
GTTGGGAACTCGCACTGTGACCTTAGCGTTTAGTTTTCTAGAGGATGTGATCTAATTTCCTCCT
AGCTCGTCATTAAAATGGAAATTGTACTAGGACCCGGGGGGATTCGAGAGGAAAAACTTGCTGC
GGCTTTGAAATCTTGACTTCCTGAAGGTCGCCGCTGAGCGAGATGGTTTGAAGCAAGGCTTCCT
GGCCTTACAAGATGCGTAGACCAGCACTACAGAGATTGCGTAGATCAACTAGAAGAGAGTGTTG
CTTTTTCTTCTGTCTTGATGGTTTTGTTCATCCTCGTGATTGTCCTTAAACAAGTGGTAAATCG
TTCCGTGTAATATTTTTTGTGCGCTGTGTAGAAGAGTGTGTGTGTGGCTTCGTTTTGTTTTTCT
TTTTTCTTTTTGCCATCGTTGATGAAAACAAGAAGTCAAATAAAGGATGTCTTCGTCTGATTGT
GATAGCGTGATTAAAGAGGAGGCAGGTGGGTGCCGATTTCACCAGGAGAGACCTTGAATGAAGG
AGTAGTGATAGCAGAGAGCACAGTTGGTGAATGGGGCTGTCTGGAAGGAAGTTATACATCAAAT
ACACAGAGCAAAAGCACTCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001007642	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68142	(Get FASTA)	NCBI Sequence Viewer
	AAR23526	(Get FASTA)	NCBI Sequence Viewer
	EDM00453	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006111
	ENSRNOP00000006111.3
	ENSRNOP00000079889.1
	ENSRNOP00055000769
	ENSRNOP00060025529
	ENSRNOP00065009801
GenBank Protein	Q6SA80	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001007642 ⟸ NM_001007641

- UniProtKB:

Q6SA80 (UniProtKB/Swiss-Prot), B4F757 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKERRASQKLSSKSIMDPNQNVKCKIVVVGDSQCGKTALLHVFAKDCFPENYVPTVFENYTASF
EIDTQRIELSLWDTSGSPYYDNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNT
KMLLVGCKSDLRTDVSTLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHV
ATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVM

hide sequence

RefSeq Acc Id:

ENSRNOP00000006111 ⟸ ENSRNOT00000006111

RefSeq Acc Id:

ENSRNOP00000079889 ⟸ ENSRNOT00000095476

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6SA80-F1-model_v2	AlphaFold	Q6SA80	1-244	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692072

Promoter ID:

EPDNEW_R2597

Type:

single initiation site

Name:

Rnd3_1

Description:

Rho family GTPase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	36,660,769 - 36,660,829	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359690	AgrOrtholog
BioCyc Gene	G2FUF-49746	BioCyc
Ensembl Genes	ENSRNOG00000004624	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055000580	UniProtKB/Swiss-Prot
	ENSRNOG00060018301	UniProtKB/Swiss-Prot
	ENSRNOG00065008337	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006111	ENTREZGENE
	ENSRNOT00000006111.7	UniProtKB/Swiss-Prot
	ENSRNOT00000095476.1	UniProtKB/TrEMBL
	ENSRNOT00055000994	UniProtKB/Swiss-Prot
	ENSRNOT00060031459	UniProtKB/Swiss-Prot
	ENSRNOT00065013234	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RhoE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase_Rho	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:295588	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	295588	ENTREZGENE
PANTHER	PTHR24072	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO-RELATED GTP-BINDING PROTEIN RHOE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ras	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rnd3	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RAB	UniProtKB/TrEMBL
	RAS	UniProtKB/TrEMBL
	RHO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004624	RatGTEx
	ENSRNOG00055000580	RatGTEx
	ENSRNOG00060018301	RatGTEx
	ENSRNOG00065008337	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RAS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RHO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZNJ1_RAT	UniProtKB/TrEMBL
	B4F757	ENTREZGENE, UniProtKB/TrEMBL
	Q6SA80	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Rnd3	Rho family GTPase 3	Arhe	ras homolog gene family, member E	Symbol and Name updated	1299863	APPROVED
2005-07-29	Arhe	ras homolog gene family, member E			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	mouse homolog binds the amino-terminal region of the Rock1 protein in the kinase domain; does not compete with carboxy-terminal Rhoa binding	1559164

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD