Advanced Search (OLGA)

Gene: Gtf2f1 (general transcription factor IIF subunit 1) Rattus norvegicus

Analyze

Symbol:

Gtf2f1

Name:

general transcription factor IIF subunit 1

RGD ID:

1359646

Description:

Predicted to enable several functions, including RNA polymerase II general transcription initiation factor activity; TFIIF-class transcription factor complex binding activity; and promoter-specific chromatin binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of transcription factor TFIID complex and transcription factor TFIIF complex. Orthologous to human GTF2F1 (general transcription factor IIF subunit 1); PARTICIPATES IN RNA polymerase II transcription elongation pathway; RNA polymerase II transcription initiation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

general transcription factor IIF, polypeptide 1; general transcription factor IIF, polypeptide 1, 74kDa; MGC94148; TFIIF-alpha; transcription initiation factor IIF subunit alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GTF2F1 (general transcription factor IIF subunit 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Gtf2f1 (general transcription factor IIF, polypeptide 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gtf2f1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GTF2F1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GTF2F1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gtf2f1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GTF2F1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GTF2F1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gtf2f1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gtf2f1 (general transcription factor IIF subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GTF2F1 (general transcription factor IIF subunit 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gtf2f1 (general transcription factor IIF, polypeptide 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gtf2f1 (general transcription factor IIF, polypeptide 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gtf-2F1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	gtf-2F1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TFG1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	TFG1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	TfIIFalpha	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtf2f1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	1,931,033 - 1,940,197 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	1,930,055 - 1,940,197 (-)	Ensembl				GRCr8
mRatBN7.2	9	1,844,027 - 1,853,455 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	1,843,901 - 1,853,423 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	2,277,798 - 2,286,963 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	7,627,157 - 7,636,322 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	6,583,019 - 6,592,184 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	10,032,806 - 10,042,392 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	10,033,011 - 10,042,418 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	9,033,464 - 9,043,042 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	9	6,664,214 - 6,673,260 (+)	NCBI		Celera
Cytogenetic Map	9	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

acetamide (EXP)

acrolein (ISO)

alpha-pinene (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Brodifacoum (EXP)

butan-1-ol (ISO)

cadmium dichloride (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

carmustine (ISO)

carnosic acid (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

coumarin (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

diazinon (ISO)

dibutyl phthalate (EXP,ISO)

elemental selenium (ISO)

ethanol (ISO)

flutamide (EXP)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

isobutanol (ISO)

ivermectin (ISO)

lead diacetate (EXP)

lead(0) (ISO)

methidathion (ISO)

methyl methanesulfonate (ISO)

miconazole (ISO)

nitrates (ISO)

ozone (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

Triptolide (ISO)

tungsten (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of transcription by RNA polymerase II (IDA,IEA,ISO)

positive regulation of transcription elongation by RNA polymerase II (IEA)

response to virus (IEA,ISO)

transcription elongation by RNA polymerase II (IEA,ISO)

transcription initiation at RNA polymerase II promoter (IBA,IEA,ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

protein-containing complex (IEA,ISO)

transcription factor TFIID complex (IEA,ISO)

transcription factor TFIIF complex (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA)

phosphatase activator activity (IEA,ISO)

promoter-specific chromatin binding (IEA,ISO,ISS)

protein binding (IPI,ISO)

protein domain specific binding (IEA,ISO)

protein phosphatase binding (IEA,ISO)

RNA polymerase II general transcription initiation factor activity (IBA,IEA,ISO)

RNA polymerase II general transcription initiation factor binding (IEA,ISO)

TFIIF-class transcription factor complex binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase II transcription elongation pathway (ISO)

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A cDNA encoding RAP74, a general initiation factor for transcription by RNA polymerase II.	Finkelstein A, etal., Nature 1992 Jan 30;355(6359):464-7.
2.	The carboxyl terminus of RAP30 is similar in sequence to region 4 of bacterial sigma factors and is required for function.	Garrett KP, etal., J Biol Chem 1992 Nov 25;267(33):23942-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Structural insights into transcription initiation by RNA polymerase II.	Grunberg S and Hahn S, Trends Biochem Sci. 2013 Dec;38(12):603-11. doi: 10.1016/j.tibs.2013.09.002. Epub 2013 Oct 11.
5.	Control of transcriptional elongation.	Kwak H and Lis JT, Annu Rev Genet. 2013;47:483-508. doi: 10.1146/annurev-genet-110711-155440. Epub 2013 Sep 11.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	Tissue and cell distribution of a mammalian proteasomal ATPase, MSS1, and its complex formation with the basal transcription factors.	Yanagi S, etal., Biochem Biophys Res Commun. 2000 Dec 20;279(2):568-73.

Additional References at PubMed

PMID:8625415	PMID:8662660	PMID:9265625	PMID:12721286	PMID:12732728	PMID:15489334	PMID:15723517	PMID:16548883	PMID:16854843	PMID:22658674	PMID:22681889	PMID:24441171
PMID:27193682

Genomics

Comparative Map Data

Gtf2f1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	1,931,033 - 1,940,197 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	1,930,055 - 1,940,197 (-)	Ensembl				GRCr8
mRatBN7.2	9	1,844,027 - 1,853,455 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	1,843,901 - 1,853,423 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	2,277,798 - 2,286,963 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	7,627,157 - 7,636,322 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	6,583,019 - 6,592,184 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	10,032,806 - 10,042,392 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	10,033,011 - 10,042,418 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	9,033,464 - 9,043,042 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	9	6,664,214 - 6,673,260 (+)	NCBI		Celera
Cytogenetic Map	9	q11	NCBI

GTF2F1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	6,379,572 - 6,393,164 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	6,379,572 - 6,393,981 (-)	Ensembl			hg38	GRCh38
GRCh37	19	6,379,583 - 6,393,175 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	6,330,580 - 6,344,291 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	6,330,580 - 6,344,184	NCBI
Celera	19	6,318,367 - 6,332,078 (-)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	6,139,725 - 6,153,437 (-)	NCBI		HuRef
CHM1_1	19	6,379,205 - 6,392,915 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	6,368,474 - 6,382,065 (-)	NCBI		T2T-CHM13v2.0

Gtf2f1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	57,310,402 - 57,318,398 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	57,310,405 - 57,318,288 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	57,003,401 - 57,011,394 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	57,003,405 - 57,011,288 (-)	Ensembl			mm10	GRCm38
MGSCv37	17	57,142,825 - 57,150,711 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	56,688,526 - 56,696,417 (-)	NCBI		MGSCv36	mm8
Celera	17	61,351,328 - 61,359,214 (-)	NCBI		Celera
Cytogenetic Map	17	D	NCBI
cM Map	17	29.62	NCBI

Gtf2f1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	3,208,733 - 3,217,163 (+)	Ensembl
ChiLan1.0	NW_004955495	3,208,334 - 3,217,460 (+)	NCBI	ChiLan1.0	ChiLan1.0

GTF2F1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	10,780,235 - 10,794,718 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	10,006,147 - 10,020,634 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	5,401,090 - 5,414,142 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	6,323,259 - 6,336,812 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	6,323,780 - 6,336,215 (-)	Ensembl			panPan2	panpan1.1

GTF2F1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	53,771,201 - 53,780,646 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	53,771,325 - 53,780,644 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	53,518,020 - 53,527,557 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	54,425,381 - 54,434,910 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	54,425,568 - 54,434,910 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	53,491,833 - 53,501,378 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	53,940,180 - 53,949,728 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	54,169,704 - 54,179,458 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gtf2f1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	214,084,208 - 214,095,837 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	3,742,921 - 3,750,196 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	3,742,880 - 3,750,400 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GTF2F1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	72,687,790 - 72,698,270 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	72,687,612 - 72,698,274 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	73,200,976 - 73,211,779 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GTF2F1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	5,996,585 - 6,006,893 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666081	2,012,088 - 2,027,210 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtf2f1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	3,513,027 - 3,521,650 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624828	3,512,990 - 3,521,848 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gtf2f1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	88,383,402 - 88,392,945 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gtf2f1
27 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	58
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000073683
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631533	Iresp3	Immunoglobin response QTL3	16.2		blood immunoglobulin E amount (VT:0002492)	serum immunoglobulin E level (CMO:0002101)	9	1	6094576	Rat
10054141	Gmadr4	Adrenal mass QTL 4	2.45	0.0074	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	9	1	21707400	Rat
9589158	Gluco65	Glucose level QTL 65	6.82	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	9	496645	45496645	Rat
7411592	Foco8	Food consumption QTL 8	7.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	496645	45496645	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	1	31250552	Rat
9589055	Scfw5	Subcutaneous fat weight QTL 5	5.55	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	9	496645	45496645	Rat
1300124	Cm4	Cardiac mass QTL 4	3.55		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	9	1	41763315	Rat

Markers in Region

RH126039

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	1,844,038 - 1,844,255 (-)	MAPPER	mRatBN7.2
Rnor_6.0	9	10,042,164 - 10,042,380	NCBI	Rnor6.0
Rnor_5.0	9	9,042,814 - 9,043,030	UniSTS	Rnor5.0
Celera	9	6,673,034 - 6,673,250	UniSTS
Cytogenetic Map	9	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073683 ⟹ ENSRNOP00000064830

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	1,930,055 - 1,940,197 (-)	Ensembl
mRatBN7.2 Ensembl	9	1,843,901 - 1,853,346 (-)	Ensembl
Rnor_6.0 Ensembl	9	10,033,011 - 10,042,418 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100918 ⟹ ENSRNOP00000076645

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	1,930,055 - 1,939,078 (-)	Ensembl
mRatBN7.2 Ensembl	9	1,844,031 - 1,852,076 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101330 ⟹ ENSRNOP00000084850

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	1,843,901 - 1,853,423 (-)	Ensembl

RefSeq Acc Id:

NM_001007711 ⟹ NP_001007712

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	1,931,033 - 1,940,197 (-)	NCBI
mRatBN7.2	9	1,844,029 - 1,853,195 (-)	NCBI
Rnor_6.0	9	10,033,028 - 10,042,390 (+)	NCBI
Rnor_5.0	9	9,033,464 - 9,043,042 (+)	NCBI
Celera	9	6,664,214 - 6,673,260 (+)	RGD

Sequence:

show sequence

GGTTTGGAAATCCAAAGCACAGGATCACACTAACGTGACAACCAGGAAAGGTGCTTTCCCTGGG
TCCGAGGGACACAACCAAGACCATCCAGGTCTGGCCGACCCGGAGCAGCTTGAGCAACGGCCAT
GGCGGCTCTAGGCTCCAGCAGCCAGAATGTCACTGAGTACGTCGTCCGAGTCCCCAAGAACACA
GCCAAAAGATACAACATAATGGCTTTTAATGCAGCTGATAAAGTCAACTTTGCTACCTGGAACC
AGGCACGGCTGGAGCGAGATCTGAGCAACAAGAAGATCTACCAGGAAGAGGAGATGCCAGAGTC
TGGTGCAGGAAGTGAATTCAACCGCAAGCTCAGGGAGGAGGCTCGCCGGAAGAAGTATGGCATC
GTCCTGAAGGAGTTCCGGCCTGAGGACCAGCCCTGGCTACTCCGTGTCAATGGCAAATCGGGGA
GGAAGTTCAAGGGCATCAAGAAAGGCGGGGTAACAGAGAACACGGCCTACTACATCTTCACACA
GTGTGCGGATGGCGCCTTCGAGGCCTTCCCTGTGCAGAACTGGTACAATTTCACACCGCTGGCC
CGACACCGCACACTGACTGCTGAGGAAGCTGAGGAGGAATGGGAGAGGAGGAACAAGGTCCTGA
ACCACTTCAGCATCATGCAGCAGCGGCGACTCAAGGACCAGGACCAGGATGAAGATGAGGAGGA
GAAGGAGAAGCGCAGCCGTAAGAAGCCTAGTGAACTGCGCATTCATGACCTGGAAGATGACCTG
GAAATGTCATCCGATGCCAGTGATGCCAGTGGAGAAGAGGGCAGCAGAGCCTCCAAGGCTAAGA
AAAAGGCCCCAGTGACCAAGGCAGGCAGGAAGAAGAAAAAGAAGAAGGGCTCAGATGATGAGGC
CTTTGAGGACAGTGATGACGGGGACTTTGAGGGCCAGGAGGTAGACTACATGTCTGACGGCTCC
AGCAGCTCACCGGATGAGGCAGAGGGCAAGCCCAAGGTGCCCCAGCAGGAGGATGGCCCCAAGG
GTGTGGACGAACAGAGTGAGAGCAGTGAGGAGAGTGAGGAGGAGAAGCCCCCCGAGGAGGACAA
GGAGGAGGAGGAAGAGAAGAAGGCCCCTACCCCACAAGAGAAGAAACGCAGGAAAGACAGCAGT
GATGACTCAGACAGCTCAGAAGAGAGCGACATTGACAGTGAGACCTCCTCTGCGCTCTTCATGG
CGAAGAAGAAGACACCCCCCAAGAGGGAGCGGAAGCCATCCGGGGGAAGTTCAAAGGGCACCAG
CCGGCCAGGAACTCCCAGTGCAGAAGCGGCAAGCACCTCTTCTACCCTGCGGGCCGCGGCCAGC
AAGCTGGAACAGGGGAAGCGGACAAGTGAGACTCCAGCAGCCAAGCGCCTTCGGATGGACACAG
GTCCCCAGAGCCTGTCTGGGAAGTCCACGCCCAGCAGCGGTGATGTCCAGGTGACAGAGGATGC
TGTGCGCCGCTACCTGACCCGGAAGCCCATGACCACGAAGGACCTGCTGAAGAAGTTCCAGACC
AAGAAGACGGGGCTGAGCAGCGAGCAGACAGTGAATGTGCTGGCGCAGATTCTCAAGCGCCTCA
ACCCTGAGCGCAAGATGATTGGGGACAAGATGCACTTCTCCCTCAAAGAGTGATGCCAATAAAG
AGAGCAGGCCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001007712	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79136	(Get FASTA)	NCBI Sequence Viewer
	EDL83591	(Get FASTA)	NCBI Sequence Viewer
	EDL83592	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064830
	ENSRNOP00000064830.1
GenBank Protein	Q6AY96	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001007712 ⟸ NM_001007711

- UniProtKB:

Q6AY96 (UniProtKB/Swiss-Prot), A0A8I5Y917 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAALGSSSQNVTEYVVRVPKNTAKRYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPE
SGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTAYYIFT
QCADGAFEAFPVQNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEE
EKEKRSRKKPSELRIHDLEDDLEMSSDASDASGEEGSRASKAKKKAPVTKAGRKKKKKKGSDDE
AFEDSDDGDFEGQEVDYMSDGSSSSPDEAEGKPKVPQQEDGPKGVDEQSESSEESEEEKPPEED
KEEEEEKKAPTPQEKKRRKDSSDDSDSSEESDIDSETSSALFMAKKKTPPKRERKPSGGSSKGT
SRPGTPSAEAASTSSTLRAAASKLEQGKRTSETPAAKRLRMDTGPQSLSGKSTPSSGDVQVTED
AVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMIGDKMHFSLKE

hide sequence

Ensembl Acc Id:

ENSRNOP00000064830 ⟸ ENSRNOT00000073683

Ensembl Acc Id:

ENSRNOP00000084850 ⟸ ENSRNOT00000101330

Ensembl Acc Id:

ENSRNOP00000076645 ⟸ ENSRNOT00000100918

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY96-F1-model_v2	AlphaFold	Q6AY96	1-508	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696443

Promoter ID:

EPDNEW_R6968

Type:

initiation region

Name:

Gtf2f1_1

Description:

general transcription factor IIF subunit 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	10,033,000 - 10,033,060	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359646	AgrOrtholog
BioCyc Gene	G2FUF-28497	BioCyc
Ensembl Genes	ENSRNOG00000047134	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000073683	ENTREZGENE
	ENSRNOT00000073683.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7127699	IMAGE-MGC_LOAD
InterPro	TFIIF-alpha	UniProtKB/Swiss-Prot
	TFIIF_interaction	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:316123	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94148	IMAGE-MGC_LOAD
NCBI Gene	316123	ENTREZGENE
PANTHER	GENERAL TRANSCRIPTION FACTOR IIF SUBUNIT 1	UniProtKB/Swiss-Prot
	PTHR13011	UniProtKB/Swiss-Prot
Pfam	TFIIF_alpha	UniProtKB/Swiss-Prot
PhenoGen	Gtf2f1	PhenoGen
RatGTEx	ENSRNOG00000047134	RatGTEx
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
	SSF50916	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y917	ENTREZGENE, UniProtKB/TrEMBL
	A6KQT3_RAT	UniProtKB/TrEMBL
	A6KQT4_RAT	UniProtKB/TrEMBL
	Q6AY96	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-25	Gtf2f1	general transcription factor IIF subunit 1	Gtf2f1	general transcription factor IIF, polypeptide 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Gtf2f1	general transcription factor IIF, polypeptide 1		general transcription factor IIF, polypeptide 1, 74kDa	Name updated	1299863	APPROVED
2005-07-29	Gtf2f1	general transcription factor IIF, polypeptide 1, 74kDa			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations