Symbol:
Gtf2f1
Name:
general transcription factor IIF subunit 1
RGD ID:
1359646
Description:
Predicted to enable several functions, including RNA polymerase II general transcription initiation factor activity; TFIIF-class transcription factor complex binding activity; and promoter-specific chromatin binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in cell junction and nucleoplasm. Predicted to be part of transcription factor TFIID complex and transcription factor TFIIF complex. Orthologous to human GTF2F1 (general transcription factor IIF subunit 1); PARTICIPATES IN RNA polymerase II transcription elongation pathway; RNA polymerase II transcription initiation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
general transcription factor IIF, polypeptide 1; general transcription factor IIF, polypeptide 1, 74kDa; MGC94148; TFIIF-alpha; transcription initiation factor IIF subunit alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GTF2F1 (general transcription factor IIF subunit 1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Gtf2f1 (general transcription factor IIF, polypeptide 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gtf2f1 (general transcription factor IIF subunit 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GTF2F1 (general transcription factor IIF subunit 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GTF2F1 (general transcription factor IIF subunit 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gtf2f1 (general transcription factor IIF subunit 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GTF2F1 (general transcription factor IIF subunit 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GTF2F1 (general transcription factor IIF subunit 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gtf2f1 (general transcription factor IIF subunit 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
GTF2F1 (general transcription factor IIF subunit 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Gtf2f1 (general transcription factor IIF, polypeptide 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gtf2f1 (general transcription factor IIF, polypeptide 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
gtf-2F1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
TFG1
Alliance
DIOPT (Ensembl Compara|Hieranoid|PANTHER)
Drosophila melanogaster (fruit fly):
TfIIFalpha
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gtf2f1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 1,931,033 - 1,940,197 (-) NCBI GRCr8 mRatBN7.2 9 1,844,027 - 1,853,455 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,843,901 - 1,853,423 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 2,277,798 - 2,286,963 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,627,157 - 7,636,322 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,583,019 - 6,592,184 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 10,032,806 - 10,042,392 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 10,033,011 - 10,042,418 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 9,033,464 - 9,043,042 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,664,214 - 6,673,260 (+) NCBI Celera Cytogenetic Map 9 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gtf2f1 Rat 17alpha-ethynylestradiol increases expression ISO Gtf2f1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of GTF2F1 mRNA CTD PMID:17942748 Gtf2f1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of GTF2F1 mRNA CTD PMID:29097150 Gtf2f1 Rat 17alpha-ethynylestradiol multiple interactions ISO Gtf2f1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GTF2F1 mRNA CTD PMID:17942748 Gtf2f1 Rat 17beta-estradiol increases expression ISO Gtf2f1 (Mus musculus) 6480464 Estradiol results in increased expression of GTF2F1 mRNA CTD PMID:39298647 Gtf2f1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Gtf2f1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Gtf2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gtf2f1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GTF2F1 mRNA CTD PMID:17942748 Gtf2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gtf2f1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GTF2F1 mRNA CTD PMID:21570461 Gtf2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GTF2F1 mRNA CTD PMID:22298810 Gtf2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GTF2F1 mRNA CTD PMID:16960034 and PMID:34747641 Gtf2f1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gtf2f1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GTF2F1 mRNA CTD PMID:16960034 Gtf2f1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of GTF2F1 mRNA CTD PMID:21346803 Gtf2f1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of GTF2F1 mRNA CTD PMID:21346803 Gtf2f1 Rat 2-methylcholine affects expression ISO GTF2F1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of GTF2F1 mRNA CTD PMID:21179406 Gtf2f1 Rat 4,4'-sulfonyldiphenol increases expression ISO Gtf2f1 (Mus musculus) 6480464 bisphenol S results in increased expression of GTF2F1 mRNA CTD PMID:39298647 Gtf2f1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GTF2F1 mRNA CTD PMID:36041667 Gtf2f1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of GTF2F1 mRNA CTD PMID:31881176 Gtf2f1 Rat acrolein multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GTF2F1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of GTF2F1 mRNA CTD PMID:32699268 Gtf2f1 Rat alpha-pinene multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GTF2F1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of GTF2F1 mRNA CTD PMID:32699268 Gtf2f1 Rat antirheumatic drug decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GTF2F1 mRNA CTD PMID:24449571 Gtf2f1 Rat aristolochic acid A increases expression ISO GTF2F1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of GTF2F1 mRNA CTD PMID:33212167 Gtf2f1 Rat benzatropine multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of GTF2F1 protein CTD PMID:34122009 Gtf2f1 Rat benzo[a]pyrene increases expression ISO Gtf2f1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of GTF2F1 mRNA CTD PMID:22228805 Gtf2f1 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO GTF2F1 (Homo sapiens) 6480464 Mustard Gas results in increased phosphorylation of GTF2F1 protein CTD PMID:19845377 Gtf2f1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gtf2f1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GTF2F1 mRNA CTD PMID:33754040 Gtf2f1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GTF2F1 mRNA CTD PMID:25181051 more ... Gtf2f1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GTF2F1 mRNA CTD PMID:36041667 Gtf2f1 Rat bisphenol A decreases expression ISO Gtf2f1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GTF2F1 mRNA CTD PMID:33221593 Gtf2f1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GTF2F1 mRNA CTD PMID:29097150 and PMID:33296240 Gtf2f1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of GTF2F1 mRNA CTD PMID:36041667 Gtf2f1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of GTF2F1 protein CTD PMID:28903499 Gtf2f1 Rat butan-1-ol multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of GTF2F1 mRNA CTD PMID:29432896 Gtf2f1 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of GTF2F1 promoter CTD PMID:22457795 Gtf2f1 Rat cannabidiol multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of GTF2F1 protein CTD PMID:34122009 Gtf2f1 Rat carbon nanotube increases expression ISO Gtf2f1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of GTF2F1 mRNA CTD PMID:25554681 Gtf2f1 Rat carmustine decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Carmustine results in decreased expression of GTF2F1 mRNA CTD PMID:15980968 Gtf2f1 Rat carnosic acid decreases expression ISO Gtf2f1 (Mus musculus) 6480464 salvin results in decreased expression of GTF2F1 protein CTD PMID:35926579 Gtf2f1 Rat chlorpyrifos decreases expression ISO Gtf2f1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of GTF2F1 mRNA CTD PMID:37019170 Gtf2f1 Rat cobalt dichloride increases expression ISO GTF2F1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of GTF2F1 mRNA CTD PMID:19320972 and PMID:19376846 Gtf2f1 Rat coumarin increases phosphorylation ISO GTF2F1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of GTF2F1 protein CTD PMID:35688186 Gtf2f1 Rat Cuprizon multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of GTF2F1 protein and [Cuprizone co-treated with Cannabidiol] results in decreased expression of GTF2F1 protein CTD PMID:34122009 Gtf2f1 Rat cyclosporin A increases expression ISO GTF2F1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of GTF2F1 mRNA CTD PMID:25562108 Gtf2f1 Rat dextran sulfate increases expression ISO Gtf2f1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of GTF2F1 mRNA CTD PMID:35093514 Gtf2f1 Rat diazinon increases methylation ISO GTF2F1 (Homo sapiens) 6480464 Diazinon results in increased methylation of GTF2F1 gene CTD PMID:22964155 Gtf2f1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of GTF2F1 mRNA CTD PMID:21266533 Gtf2f1 Rat dibutyl phthalate decreases expression ISO Gtf2f1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of GTF2F1 mRNA CTD PMID:17361019 Gtf2f1 Rat elemental selenium increases expression ISO GTF2F1 (Homo sapiens) 6480464 Selenium results in increased expression of GTF2F1 mRNA CTD PMID:19244175 Gtf2f1 Rat ethanol affects expression ISO Gtf2f1 (Mus musculus) 6480464 Ethanol affects the expression of GTF2F1 mRNA CTD PMID:30319688 Gtf2f1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of GTF2F1 mRNA CTD PMID:24136188 Gtf2f1 Rat FR900359 affects phosphorylation ISO GTF2F1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of GTF2F1 protein CTD PMID:37730182 Gtf2f1 Rat genistein decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Genistein results in decreased expression of GTF2F1 mRNA CTD PMID:16705744 Gtf2f1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GTF2F1 mRNA CTD PMID:33387578 Gtf2f1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of GTF2F1 mRNA CTD PMID:24136188 Gtf2f1 Rat isobutanol multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of GTF2F1 mRNA CTD PMID:29432896 Gtf2f1 Rat ivermectin decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GTF2F1 protein CTD PMID:32959892 Gtf2f1 Rat lead diacetate affects expression EXP 6480464 lead acetate affects the expression of GTF2F1 protein CTD PMID:36539177 Gtf2f1 Rat lead(0) decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Lead results in decreased expression of GTF2F1 mRNA CTD PMID:19921347 Gtf2f1 Rat methidathion decreases expression ISO Gtf2f1 (Mus musculus) 6480464 methidathion results in decreased expression of GTF2F1 mRNA CTD PMID:34813904 Gtf2f1 Rat methyl methanesulfonate increases expression ISO GTF2F1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of GTF2F1 mRNA CTD PMID:23649840 Gtf2f1 Rat miconazole increases expression ISO Gtf2f1 (Mus musculus) 6480464 Miconazole results in increased expression of GTF2F1 mRNA CTD PMID:27462272 Gtf2f1 Rat nitrates multiple interactions ISO Gtf2f1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GTF2F1 mRNA CTD PMID:35964746 Gtf2f1 Rat ozone multiple interactions ISO GTF2F1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of GTF2F1 mRNA more ... CTD PMID:32699268 and PMID:35430440 Gtf2f1 Rat ozone decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Ozone results in decreased expression of GTF2F1 mRNA CTD PMID:23033980 Gtf2f1 Rat paracetamol affects expression ISO Gtf2f1 (Mus musculus) 6480464 Acetaminophen affects the expression of GTF2F1 mRNA CTD PMID:17562736 Gtf2f1 Rat pirinixic acid decreases expression ISO Gtf2f1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of GTF2F1 mRNA CTD PMID:17426115 Gtf2f1 Rat pirinixic acid increases expression ISO Gtf2f1 (Mus musculus) 6480464 pirinixic acid results in increased expression of GTF2F1 mRNA CTD PMID:18301758 Gtf2f1 Rat selenium atom increases expression ISO GTF2F1 (Homo sapiens) 6480464 Selenium results in increased expression of GTF2F1 mRNA CTD PMID:19244175 Gtf2f1 Rat sodium arsenite increases expression ISO GTF2F1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GTF2F1 mRNA CTD PMID:38568856 Gtf2f1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of GTF2F1 mRNA CTD PMID:25993096 Gtf2f1 Rat tert-butyl hydroperoxide decreases expression ISO GTF2F1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of GTF2F1 mRNA CTD PMID:15336504 Gtf2f1 Rat tetrachloroethene decreases expression ISO Gtf2f1 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of GTF2F1 mRNA CTD PMID:28973375 Gtf2f1 Rat tetrachloromethane increases expression ISO Gtf2f1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of GTF2F1 mRNA CTD PMID:27339419 and PMID:31919559 Gtf2f1 Rat thimerosal decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of GTF2F1 mRNA CTD PMID:27188386 Gtf2f1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of GTF2F1 mRNA CTD PMID:23411599 and PMID:34492290 Gtf2f1 Rat thiram increases expression ISO GTF2F1 (Homo sapiens) 6480464 Thiram results in increased expression of GTF2F1 mRNA CTD PMID:38568856 Gtf2f1 Rat titanium dioxide decreases methylation ISO Gtf2f1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GTF2F1 gene and titanium dioxide results in decreased methylation of GTF2F1 promoter CTD PMID:35295148 Gtf2f1 Rat triphenyl phosphate affects expression ISO GTF2F1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GTF2F1 mRNA CTD PMID:37042841 Gtf2f1 Rat Triptolide increases expression ISO Gtf2f1 (Mus musculus) 6480464 triptolide results in increased expression of GTF2F1 mRNA CTD PMID:32835833 Gtf2f1 Rat tungsten decreases expression ISO Gtf2f1 (Mus musculus) 6480464 Tungsten results in decreased expression of GTF2F1 mRNA CTD PMID:30912803 Gtf2f1 Rat valproic acid affects expression ISO Gtf2f1 (Mus musculus) 6480464 Valproic Acid affects the expression of GTF2F1 mRNA CTD PMID:17292431 Gtf2f1 Rat valproic acid increases expression ISO GTF2F1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GTF2F1 mRNA CTD PMID:23179753 Gtf2f1 Rat valproic acid increases methylation ISO GTF2F1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GTF2F1 gene CTD PMID:29154799 Gtf2f1 Rat vitamin E decreases expression ISO GTF2F1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of GTF2F1 mRNA CTD PMID:19244175
17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) acetamide (EXP) acrolein (ISO) alpha-pinene (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) Brodifacoum (EXP) butan-1-ol (ISO) cadmium dichloride (EXP) cannabidiol (ISO) carbon nanotube (ISO) carmustine (ISO) carnosic acid (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) coumarin (ISO) Cuprizon (ISO) cyclosporin A (ISO) dextran sulfate (ISO) diazinon (ISO) dibutyl phthalate (EXP,ISO) elemental selenium (ISO) ethanol (ISO) flutamide (EXP) FR900359 (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) isobutanol (ISO) ivermectin (ISO) lead diacetate (EXP) lead(0) (ISO) methidathion (ISO) methyl methanesulfonate (ISO) miconazole (ISO) nitrates (ISO) ozone (ISO) paracetamol (ISO) pirinixic acid (ISO) selenium atom (ISO) sodium arsenite (ISO) sodium dichromate (EXP) tert-butyl hydroperoxide (ISO) tetrachloroethene (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) Triptolide (ISO) tungsten (ISO) valproic acid (ISO) vitamin E (ISO)
1.
A cDNA encoding RAP74, a general initiation factor for transcription by RNA polymerase II.
Finkelstein A, etal., Nature 1992 Jan 30;355(6359):464-7.
2.
The carboxyl terminus of RAP30 is similar in sequence to region 4 of bacterial sigma factors and is required for function.
Garrett KP, etal., J Biol Chem 1992 Nov 25;267(33):23942-9.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Structural insights into transcription initiation by RNA polymerase II.
Grunberg S and Hahn S, Trends Biochem Sci. 2013 Dec;38(12):603-11. doi: 10.1016/j.tibs.2013.09.002. Epub 2013 Oct 11.
5.
Control of transcriptional elongation.
Kwak H and Lis JT, Annu Rev Genet. 2013;47:483-508. doi: 10.1146/annurev-genet-110711-155440. Epub 2013 Sep 11.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
GOA pipeline
RGD automated data pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Comprehensive gene review and curation
RGD comprehensive gene curation
11.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.
Tissue and cell distribution of a mammalian proteasomal ATPase, MSS1, and its complex formation with the basal transcription factors.
Yanagi S, etal., Biochem Biophys Res Commun. 2000 Dec 20;279(2):568-73.
Gtf2f1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 1,931,033 - 1,940,197 (-) NCBI GRCr8 mRatBN7.2 9 1,844,027 - 1,853,455 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 1,843,901 - 1,853,423 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 2,277,798 - 2,286,963 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 7,627,157 - 7,636,322 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 6,583,019 - 6,592,184 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 10,032,806 - 10,042,392 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 10,033,011 - 10,042,418 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 9,033,464 - 9,043,042 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 9 6,664,214 - 6,673,260 (+) NCBI Celera Cytogenetic Map 9 q11 NCBI
GTF2F1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 6,379,572 - 6,393,164 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 6,379,572 - 6,393,981 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 6,379,583 - 6,393,175 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 6,330,580 - 6,344,291 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 6,330,580 - 6,344,184 NCBI Celera 19 6,318,367 - 6,332,078 (-) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 6,139,725 - 6,153,437 (-) NCBI HuRef CHM1_1 19 6,379,205 - 6,392,915 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 6,368,474 - 6,382,065 (-) NCBI T2T-CHM13v2.0
Gtf2f1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 57,310,402 - 57,318,398 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 57,310,405 - 57,318,288 (-) Ensembl GRCm39 Ensembl GRCm38 17 57,003,401 - 57,011,394 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 57,003,405 - 57,011,288 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 57,142,825 - 57,150,711 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 56,688,526 - 56,696,417 (-) NCBI MGSCv36 mm8 Celera 17 61,351,328 - 61,359,214 (-) NCBI Celera Cytogenetic Map 17 D NCBI cM Map 17 29.62 NCBI
Gtf2f1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 3,208,733 - 3,217,163 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 3,208,334 - 3,217,460 (+) NCBI ChiLan1.0 ChiLan1.0
GTF2F1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 10,780,235 - 10,794,718 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 10,006,147 - 10,020,634 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 5,401,090 - 5,414,142 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 6,323,259 - 6,336,812 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 6,323,780 - 6,336,215 (-) Ensembl panpan1.1 panPan2
GTF2F1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 53,771,201 - 53,780,646 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 53,771,325 - 53,780,644 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 53,518,020 - 53,527,557 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 54,425,381 - 54,434,910 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 54,425,568 - 54,434,910 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 53,491,833 - 53,501,378 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 53,940,180 - 53,949,728 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 54,169,704 - 54,179,458 (+) NCBI UU_Cfam_GSD_1.0
Gtf2f1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 214,084,208 - 214,095,837 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 3,742,921 - 3,750,196 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 3,742,880 - 3,750,400 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GTF2F1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 72,687,790 - 72,698,270 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 72,687,612 - 72,698,274 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 73,200,976 - 73,211,779 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GTF2F1 (Chlorocebus sabaeus - green monkey)
Gtf2f1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 64 Count of miRNA genes: 58 Interacting mature miRNAs: 62 Transcripts: ENSRNOT00000073683 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 10054141 Gmadr4 Adrenal mass QTL 4 2.45 0.0074 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 9 1 14209783 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat
RH126039
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 1,844,038 - 1,844,255 (-) MAPPER mRatBN7.2 Rnor_6.0 9 10,042,164 - 10,042,380 NCBI Rnor6.0 Rnor_5.0 9 9,042,814 - 9,043,030 UniSTS Rnor5.0 Celera 9 6,673,034 - 6,673,250 UniSTS Cytogenetic Map 9 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000073683 ⟹ ENSRNOP00000064830
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 1,843,901 - 1,853,346 (-) Ensembl Rnor_6.0 Ensembl 9 10,033,011 - 10,042,418 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100918 ⟹ ENSRNOP00000076645
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 1,844,031 - 1,852,076 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101330 ⟹ ENSRNOP00000084850
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 1,843,901 - 1,853,423 (-) Ensembl
RefSeq Acc Id:
NM_001007711 ⟹ NP_001007712
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 1,931,033 - 1,940,197 (-) NCBI mRatBN7.2 9 1,844,029 - 1,853,195 (-) NCBI Rnor_6.0 9 10,033,028 - 10,042,390 (+) NCBI Rnor_5.0 9 9,033,464 - 9,043,042 (+) NCBI Celera 9 6,664,214 - 6,673,260 (+) RGD
Sequence:
GGTTTGGAAATCCAAAGCACAGGATCACACTAACGTGACAACCAGGAAAGGTGCTTTCCCTGGGTCCGAGGGACACAACCAAGACCATCCAGGTCTGGCCGACCCGGAGCAGCTTGAGCAACGGCCAT GGCGGCTCTAGGCTCCAGCAGCCAGAATGTCACTGAGTACGTCGTCCGAGTCCCCAAGAACACAGCCAAAAGATACAACATAATGGCTTTTAATGCAGCTGATAAAGTCAACTTTGCTACCTGGAACC AGGCACGGCTGGAGCGAGATCTGAGCAACAAGAAGATCTACCAGGAAGAGGAGATGCCAGAGTCTGGTGCAGGAAGTGAATTCAACCGCAAGCTCAGGGAGGAGGCTCGCCGGAAGAAGTATGGCATC GTCCTGAAGGAGTTCCGGCCTGAGGACCAGCCCTGGCTACTCCGTGTCAATGGCAAATCGGGGAGGAAGTTCAAGGGCATCAAGAAAGGCGGGGTAACAGAGAACACGGCCTACTACATCTTCACACA GTGTGCGGATGGCGCCTTCGAGGCCTTCCCTGTGCAGAACTGGTACAATTTCACACCGCTGGCCCGACACCGCACACTGACTGCTGAGGAAGCTGAGGAGGAATGGGAGAGGAGGAACAAGGTCCTGA ACCACTTCAGCATCATGCAGCAGCGGCGACTCAAGGACCAGGACCAGGATGAAGATGAGGAGGAGAAGGAGAAGCGCAGCCGTAAGAAGCCTAGTGAACTGCGCATTCATGACCTGGAAGATGACCTG GAAATGTCATCCGATGCCAGTGATGCCAGTGGAGAAGAGGGCAGCAGAGCCTCCAAGGCTAAGAAAAAGGCCCCAGTGACCAAGGCAGGCAGGAAGAAGAAAAAGAAGAAGGGCTCAGATGATGAGGC CTTTGAGGACAGTGATGACGGGGACTTTGAGGGCCAGGAGGTAGACTACATGTCTGACGGCTCCAGCAGCTCACCGGATGAGGCAGAGGGCAAGCCCAAGGTGCCCCAGCAGGAGGATGGCCCCAAGG GTGTGGACGAACAGAGTGAGAGCAGTGAGGAGAGTGAGGAGGAGAAGCCCCCCGAGGAGGACAAGGAGGAGGAGGAAGAGAAGAAGGCCCCTACCCCACAAGAGAAGAAACGCAGGAAAGACAGCAGT GATGACTCAGACAGCTCAGAAGAGAGCGACATTGACAGTGAGACCTCCTCTGCGCTCTTCATGGCGAAGAAGAAGACACCCCCCAAGAGGGAGCGGAAGCCATCCGGGGGAAGTTCAAAGGGCACCAG CCGGCCAGGAACTCCCAGTGCAGAAGCGGCAAGCACCTCTTCTACCCTGCGGGCCGCGGCCAGCAAGCTGGAACAGGGGAAGCGGACAAGTGAGACTCCAGCAGCCAAGCGCCTTCGGATGGACACAG GTCCCCAGAGCCTGTCTGGGAAGTCCACGCCCAGCAGCGGTGATGTCCAGGTGACAGAGGATGCTGTGCGCCGCTACCTGACCCGGAAGCCCATGACCACGAAGGACCTGCTGAAGAAGTTCCAGACC AAGAAGACGGGGCTGAGCAGCGAGCAGACAGTGAATGTGCTGGCGCAGATTCTCAAGCGCCTCAACCCTGAGCGCAAGATGATTGGGGACAAGATGCACTTCTCCCTCAAAGAGTGATGCCAATAAAG AGAGCAGGCCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_001007712 ⟸ NM_001007711
- UniProtKB:
Q6AY96 (UniProtKB/Swiss-Prot), A0A8I5Y917 (UniProtKB/TrEMBL)
- Sequence:
MAALGSSSQNVTEYVVRVPKNTAKRYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTAYYIFT QCADGAFEAFPVQNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRSRKKPSELRIHDLEDDLEMSSDASDASGEEGSRASKAKKKAPVTKAGRKKKKKKGSDDE AFEDSDDGDFEGQEVDYMSDGSSSSPDEAEGKPKVPQQEDGPKGVDEQSESSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSDDSDSSEESDIDSETSSALFMAKKKTPPKRERKPSGGSSKGT SRPGTPSAEAASTSSTLRAAASKLEQGKRTSETPAAKRLRMDTGPQSLSGKSTPSSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMIGDKMHFSLKE
hide sequence
Ensembl Acc Id:
ENSRNOP00000064830 ⟸ ENSRNOT00000073683
Ensembl Acc Id:
ENSRNOP00000084850 ⟸ ENSRNOT00000101330
Ensembl Acc Id:
ENSRNOP00000076645 ⟸ ENSRNOT00000100918
RGD ID: 13696443
Promoter ID: EPDNEW_R6968
Type: initiation region
Name: Gtf2f1_1
Description: general transcription factor IIF subunit 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 10,033,000 - 10,033,060 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-25
Gtf2f1
general transcription factor IIF subunit 1
Gtf2f1
general transcription factor IIF, polypeptide 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2006-03-30
Gtf2f1
general transcription factor IIF, polypeptide 1
general transcription factor IIF, polypeptide 1, 74kDa
Name updated
1299863
APPROVED
2005-07-29
Gtf2f1
general transcription factor IIF, polypeptide 1, 74kDa
Symbol and Name status set to provisional
70820
PROVISIONAL