Advanced Search (OLGA)

Gene: Esrrb (estrogen-related receptor beta) Rattus norvegicus

Analyze

Symbol:

Esrrb

Name:

estrogen-related receptor beta

RGD ID:

1359557

Description:

Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II complex binding activity; and estrogen response element binding activity. Involved in positive regulation of glycogen biosynthetic process and positive regulation of glycolytic process. Predicted to be located in condensed chromosome and cytoplasm. Predicted to be part of integrator complex. Predicted to be active in chromatin and nucleus. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 35. Orthologous to human ESRRB (estrogen related receptor beta); INTERACTS WITH 17beta-estradiol; 2,3,7,8-Tetrachlorodibenzofuran; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ERR-beta; Err2; Errb; estrogen receptor-like 2; estrogen-related receptor, beta; LOC108351279; nuclear receptor subfamily 3 group B member 2; steroid hormone receptor ERR2; uncharacterized LOC108351279

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ESRRB (estrogen related receptor beta)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Esrrb (estrogen related receptor, beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Esrrb (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ESRRB (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ESRRB (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Esrrb (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ESRRB (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ESRRB (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Esrrb (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Esrrb (estrogen related receptor beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ESRRG (estrogen related receptor gamma)	HGNC	OrthoDB
Homo sapiens (human):	PERP (p53 apoptosis effector related to PMP22)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ESRRB (estrogen related receptor beta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Esrrb (estrogen related receptor, beta)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	esrrb (estrogen-related receptor beta)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	esrrb (estrogen-related receptor beta)	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	ERR	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ERR	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	esrrb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	esrrb	Alliance	DIOPT (PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	111,738,662 - 111,894,087 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	111,738,662 - 111,894,087 (+)	Ensembl				GRCr8
mRatBN7.2	6	106,007,701 - 106,163,136 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	106,008,095 - 106,160,791 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	106,282,013 - 106,328,257 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	106,580,916 - 106,627,164 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	105,950,549 - 105,996,797 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	110,360,940 - 110,458,406 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	110,410,141 - 110,455,906 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	119,600,549 - 119,756,691 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	110,589,116 - 110,635,158 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	103,940,309 - 103,986,414 (+)	NCBI		Celera
RGSC_v3.1	X	146,790,537 - 146,792,860 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive nonsyndromic deafness (ISO)

autosomal recessive nonsyndromic deafness 35 (ISO)

dilated cardiomyopathy (ISS)

Hearing Loss (ISO)

primary ovarian insufficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

biochanin A (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cisplatin (ISO)

cyproconazole (ISO)

daidzein (ISO)

diethylstilbestrol (ISO)

ethylparaben (ISO)

flavone (ISO)

fulvestrant (ISO)

genistein (ISO)

GS-441524 (ISO)

hexaconazole (ISO)

inulin (ISO)

isoflavones (ISO)

lead(0) (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

monosodium L-glutamate (ISO)

Nonylphenol (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

remdesivir (ISO)

rotenone (ISO)

tetrachloroethene (ISO)

titanium dioxide (ISO)

Triptolide (EXP)

troglitazone (ISO)

valproic acid (EXP,ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell dedifferentiation (ISO,ISS)

cell population proliferation (ISO,ISS)

DNA-templated transcription (IEA)

embryonic placenta development (ISO)

gene expression (ISO)

in utero embryonic development (ISO)

inner ear development (ISO,ISS)

intracellular receptor signaling pathway (IEA)

morula formation (ISO,ISS)

negative regulation of DNA-templated transcription (ISO,ISS)

negative regulation of stem cell differentiation (ISO,ISS)

nuclear receptor-mediated steroid hormone signaling pathway (IEA)

photoreceptor cell maintenance (ISO,ISS)

positive regulation of DNA-templated transcription (ISO,ISS)

positive regulation of glycogen biosynthetic process (IDA,ISO)

positive regulation of glycolytic process (IDA)

positive regulation of stem cell population maintenance (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

regulation of DNA-templated transcription (IEA,ISO,ISS)

regulation of macromolecule biosynthetic process (IEA)

regulation of stem cell division (ISO,ISS)

regulation of transcription by RNA polymerase II (IBA)

somatic stem cell population maintenance (ISO,ISS)

stem cell division (ISO,ISS)

stem cell population maintenance (ISO,ISS)

trophectodermal cell proliferation (ISO)

trophectodermal cellular morphogenesis (ISO)

Cellular Component

chromatin (IBA)

chromosome (IEA)

condensed chromosome (ISO,ISS)

cytoplasm (IEA,ISO,ISS)

integrator complex (ISO,ISS)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

cis-regulatory region sequence-specific DNA binding (ISO,ISS)

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO,ISS)

DNA-binding transcription factor activity (IEA,ISO,ISS)

DNA-binding transcription factor activity, RNA polymerase II-specific (ISO,ISS)

estrogen response element binding (IBA)

metal ion binding (IEA)

nuclear receptor activity (IBA,ISO,ISS)

nuclear steroid receptor activity (IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO,ISS)

RNA polymerase II complex binding (ISO,ISS)

RNA polymerase II-specific DNA-binding transcription factor binding (ISO)

sequence-specific DNA binding (IEA,ISO,ISS)

sequence-specific double-stranded DNA binding (ISO)

steroid binding (IEA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Multifaceted roles of miR-1s in repressing the fetal gene program in the heart.	Wei Y, etal., Cell Res. 2014 Mar;24(3):278-92. doi: 10.1038/cr.2014.12. Epub 2014 Jan 31.

Additional References at PubMed

PMID:3267207	PMID:9285590	PMID:10072763	PMID:12654265	PMID:16518401	PMID:16767105	PMID:17765677	PMID:17920186	PMID:18472334	PMID:18662995	PMID:18957414	PMID:19755138
PMID:20534447	PMID:20720539	PMID:22977234	PMID:23019124	PMID:23040477	PMID:23040478	PMID:23169531	PMID:23508100	PMID:23836911	PMID:25522312	PMID:25737630	PMID:26206133
PMID:26523946	PMID:27601327	PMID:27723719

Genomics

Comparative Map Data

Esrrb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	111,738,662 - 111,894,087 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	111,738,662 - 111,894,087 (+)	Ensembl				GRCr8
mRatBN7.2	6	106,007,701 - 106,163,136 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	106,008,095 - 106,160,791 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	106,282,013 - 106,328,257 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	106,580,916 - 106,627,164 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	105,950,549 - 105,996,797 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	110,360,940 - 110,458,406 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	110,410,141 - 110,455,906 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	119,600,549 - 119,756,691 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	110,589,116 - 110,635,158 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	103,940,309 - 103,986,414 (+)	NCBI		Celera
RGSC_v3.1	X	146,790,537 - 146,792,860 (+)	NCBI
Cytogenetic Map	6	q31	NCBI

ESRRB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	76,310,777 - 76,501,837 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	76,310,712 - 76,501,837 (+)	Ensembl			hg38	GRCh38
GRCh37	14	76,777,120 - 76,968,180 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	75,907,479 - 76,036,961 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	75,907,478 - 76,036,961	NCBI
Celera	14	56,875,493 - 57,005,971 (+)	NCBI		Celera
Cytogenetic Map	14	q24.3	NCBI
HuRef	14	57,006,242 - 57,136,798 (+)	NCBI		HuRef
CHM1_1	14	76,775,473 - 76,905,976 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	70,444,839 - 70,711,195 (+)	NCBI		T2T-CHM13v2.0

Esrrb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	86,407,891 - 86,568,402 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	86,407,891 - 86,568,402 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	86,361,117 - 86,521,628 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	86,361,117 - 86,521,628 (+)	Ensembl			mm10	GRCm38
MGSCv37	12	87,702,067 - 87,862,578 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	87,250,220 - 87,410,725 (+)	NCBI		MGSCv36	mm8
Celera	12	87,822,322 - 87,982,916 (+)	NCBI		Celera
Cytogenetic Map	12	D2	NCBI
cM Map	12	40.49	NCBI

Esrrb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	365,137 - 534,666 (+)	Ensembl
ChiLan1.0	NW_004955438	365,375 - 534,086 (+)	NCBI	ChiLan1.0	ChiLan1.0

ESRRB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	77,399,202 - 77,591,180 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	76,615,708 - 76,807,686 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	56,868,361 - 57,060,552 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	75,659,836 - 76,264,827 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	75,839,333 - 76,266,895 (+)	Ensembl			panPan2	panpan1.1

ESRRB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	49,253,877 - 49,424,148 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	49,253,332 - 49,421,332 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	48,993,759 - 49,108,098 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	49,536,327 - 49,651,095 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	49,478,199 - 49,651,088 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	49,207,343 - 49,321,606 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	49,229,899 - 49,344,297 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	49,627,923 - 49,742,343 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Esrrb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	26,614,392 - 26,718,863 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	5,292,466 - 5,454,689 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	5,350,133 - 5,452,366 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ESRRB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	99,514,168 - 99,699,011 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	99,511,135 - 99,699,478 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	105,560,818 - 105,743,671 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ESRRB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	53,630,998 - 53,762,098 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666053	41,843,619 - 41,970,318 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Esrrb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	25,261,493 - 25,430,045 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	25,261,493 - 25,369,092 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Esrrb
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	100,515,640 - 100,610,913 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Esrrb
1193 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	114
Count of miRNA genes:	92
Interacting mature miRNAs:	97
Transcripts:	ENSRNOT00000013867
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	110921244	147156653	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	99708426	112483760	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
12	12	62	138	51	52	26	20	26	6	238	111	9	113	81	79	26	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY383731	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013867 ⟹ ENSRNOP00000013867

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	111,797,737 - 111,894,087 (+)	Ensembl
mRatBN7.2 Ensembl	6	106,008,095 - 106,160,791 (+)	Ensembl
Rnor_6.0 Ensembl	6	110,410,141 - 110,455,906 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102296 ⟹ ENSRNOP00000089638

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	111,797,686 - 111,894,087 (+)	Ensembl
mRatBN7.2 Ensembl	6	106,066,843 - 106,160,791 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000149756 ⟹ ENSRNOP00000110671

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	111,738,662 - 111,894,087 (+)	Ensembl

RefSeq Acc Id:

NM_001008516 ⟹ NP_001008516

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	111,738,662 - 111,894,087 (+)	NCBI
mRatBN7.2	6	106,007,701 - 106,163,133 (+)	NCBI
Rnor_6.0	6	110,410,141 - 110,455,906 (+)	NCBI
Rnor_5.0	6	119,600,549 - 119,756,691 (+)	NCBI
RGSC_v3.4	6	110,589,116 - 110,635,158 (+)	RGD
Celera	6	103,940,309 - 103,986,414 (+)	RGD

Sequence:

show sequence

ATGTCGTCCGAAGACAGGCACCTGGGCTCTAGCTGCGGCTCCTTCATCAAGACGGAGCCATCTA
GCCCATCCTCGGGCATTGATGCCCTCAGCCACCACAGCCCCAGCGGCTCGTCGGACGCCAGCGG
TGGCTTTGGCATGGCCCTGGGCACCCACGCCAACGGTCTGGACTCTCCGCCTATGTTCGCAGGT
GCGGGGCTGGGAGGCAACCCGTGTCGCAAGAGCTACGAGGACTGTACTAGCGGTATCATGGAGG
ACTCGGCCATCAAGTGCGAGTACATGCTTAACGCCATCCCCAAGCGCCTGTGCCTCGTGTGCGG
GGACATTGCTTCTGGCTACCACTATGGAGTGGCCTCCTGCGAGGCTTGCAAGGCGTTCTTCAAG
AGAACCATTCAAGGAAACATCGAATACAGCTGCCCTGCCACCAACGAGTGTGAGATCACCAAAC
GGAGGCGCAAGTCCTGTCAGGCCTGCCGGTTCATGAAATGCCTCAAAGTGGGGATGCTGAAGGA
AGGCGTGCGCCTTGACCGGGTGCGAGGAGGCCGCCAGAAGTACAAGAGACGGCTGGATTCGGAG
AACAGCCCCTACCTGAGCTTACAGATTTCCCCGCCTGCTAAAAAGCCATTGACTAAGATTGTCT
CGTATCTACTGGTGGCCGAGCCGGACAAGCTGTACGCTATGCCTCCCGACGATGTGCCTGAAGG
GGATATCAAGGCCCTGACCACTCTCTGTGACTTGGCAGATCGGGAGCTTGTGTTCCTCATTAGC
TGGGCCAAGCACATCCCAGGTTTCTCCAACCTGACACTCGGGGACCAGATGAGCCTGCTGCAGA
GTGCCTGGATGGAGATCCTCATCCTGGGCATCGTGTACCGCTCGCTTCCCTATGATGACAAGCT
GGCATACGCGGAGGACTATATCATGGATGAGGAACACTCTCGCCTGGTGGGGCTGCTGGAGCTT
TACCGAGCCATCTTGCAGCTCGTACGCAGGTACAAGAAGCTCAAGGTGGAGAAGGAAGAGTTTG
TGATGCTCAAAGCCCTGGCCCTTGCCAACTCAGATTCAATGTACATCGAGAACCTGGAGGCTGT
GCAGAAGCTTCAGGACCTGCTGCATGAGGCGCTGCAGGACTATGAGCTGAGCCAGCGCCATGAG
GAGCCACGGAGGGCGGGCAAGCTGCTGTTGACACTGCCCCTGCTGCGGCAGACGGCAGCCAAAG
CCGTCCAGCACTTCTACAGTGTGAAACTGCAGGGCAAGGTGCCCATGCACAAACTCTTCCTGGA
GATGCTGGAGGCCAAGGTGTGA

hide sequence

RefSeq Acc Id:

XM_039112056 ⟹ XP_038967984

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	111,797,527 - 111,894,087 (+)	NCBI
mRatBN7.2	6	106,064,105 - 106,163,136 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001008516	(Get FASTA)	NCBI Sequence Viewer
	XP_038967984	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAR89824	(Get FASTA)	NCBI Sequence Viewer
	EDL81605	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000089638
	ENSRNOP00000110671
GenBank Protein	P11475	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001008516 ⟸ NM_001008516

- UniProtKB:

A0A8L2Q6Q4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSEDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGMALGTHANGLDSPPMFAG
AGLGGNPCRKSYEDCTSGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFK
RTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSE
NSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPDDVPEGDIKALTTLCDLADRELVFLIS
WAKHIPGFSNLTLGDQMSLLQSAWMEILILGIVYRSLPYDDKLAYAEDYIMDEEHSRLVGLLEL
YRAILQLVRRYKKLKVEKEEFVMLKALALANSDSMYIENLEAVQKLQDLLHEALQDYELSQRHE
EPRRAGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV

hide sequence

Ensembl Acc Id:

ENSRNOP00000013867 ⟸ ENSRNOT00000013867

RefSeq Acc Id:	XP_038967984 ⟸ XM_039112056
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A8M0 (UniProtKB/TrEMBL), A6JE61 (UniProtKB/TrEMBL), A0A8L2Q6Q4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000089638 ⟸ ENSRNOT00000102296

Ensembl Acc Id:

ENSRNOP00000110671 ⟸ ENSRNOT00000149756

Protein Domains

NR LBD Nuclear receptor

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P11475-F1-model_v2	AlphaFold	P11475	1-433	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359557	AgrOrtholog
BioCyc Gene	G2FUF-36759	BioCyc
Ensembl Genes	ENSRNOG00000010259	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000102296	ENTREZGENE
	ENSRNOT00000149756	ENTREZGENE
Gene3D-CATH	1.10.565.10	UniProtKB/Swiss-Prot
	3.30.50.10	UniProtKB/Swiss-Prot
InterPro	NHR-like_dom_sf	UniProtKB/Swiss-Prot
	Nucl_hrmn_rcpt_lig-bd	UniProtKB/Swiss-Prot
	Nuclear_hormone_rcpt_NR3	UniProtKB/Swiss-Prot
	Nuclear_hrmn_rcpt	UniProtKB/Swiss-Prot
	Oest-rel_rcp	UniProtKB/Swiss-Prot
	Oest_rcpt/oest-rel_rcp	UniProtKB/Swiss-Prot
	Znf_hrmn_rcpt	UniProtKB/Swiss-Prot
	Znf_NHR/GATA	UniProtKB/Swiss-Prot
KEGG Report	rno:299210	UniProtKB/Swiss-Prot
NCBI Gene	299210	ENTREZGENE
PANTHER	KNIRPS-RELATED PROTEIN-RELATED	UniProtKB/Swiss-Prot
Pfam	Hormone_recep	UniProtKB/Swiss-Prot
	zf-C4	UniProtKB/Swiss-Prot
PhenoGen	Esrrb	PhenoGen
PIRSF	ER-like_NR	UniProtKB/Swiss-Prot
	ERR1-2-3	UniProtKB/Swiss-Prot
PRINTS	STRDHORMONER	UniProtKB/Swiss-Prot
	STROIDFINGER	UniProtKB/Swiss-Prot
PROSITE	NR_LBD	UniProtKB/Swiss-Prot
	NUCLEAR_REC_DBD_1	UniProtKB/Swiss-Prot
	NUCLEAR_REC_DBD_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010259	RatGTEx
SMART	HOLI	UniProtKB/Swiss-Prot
	ZnF_C4	UniProtKB/Swiss-Prot
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/Swiss-Prot
	SSF48508	UniProtKB/Swiss-Prot
UniProt	A0A8I6A8M0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q6Q4	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LWC4_RAT	UniProtKB/TrEMBL
	A6JE61	ENTREZGENE, UniProtKB/TrEMBL
	ERR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	Q5QJB1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Esrrb	estrogen-related receptor beta	LOC108351279	uncharacterized LOC108351279	Data merged from RGD:11410186	737654	PROVISIONAL
2016-08-02	LOC108351279	uncharacterized LOC108351279			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-07-29	Esrrb	estrogen-related receptor beta			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM