Advanced Search (OLGA)

Gene: Rsrp1 (arginine and serine rich protein 1) Rattus norvegicus

Analyze

Symbol:

Rsrp1

Name:

arginine and serine rich protein 1

RGD ID:

1359529

Description:

Predicted to be involved in spliceosomal complex assembly. Predicted to be located in nucleus. Orthologous to human RSRP1 (arginine and serine rich protein 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

arginine/serine-rich protein 1; hypothetical protein LOC362626; LOC362626; RGD1359529; similar to chromosome 1 open reading frame 63; similar to hypothetical protein dJ465N24.2.1; UPF0471 protein C1orf63 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	152,431,448 - 152,435,202 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	152,431,478 - 152,435,126 (+)	Ensembl				GRCr8
mRatBN7.2	5	147,147,774 - 147,151,523 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	147,147,784 - 147,151,523 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	149,848,500 - 149,852,227 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	151,619,934 - 151,623,673 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	151,604,742 - 151,608,469 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	153,260,930 - 153,264,669 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	153,260,930 - 153,264,669 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	157,029,893 - 157,033,632 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	153,698,946 - 153,702,685 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	145,559,973 - 145,563,712 (+)	NCBI		Celera
RGSC_v3.1	5	153,709,036 - 153,712,648 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

arrhythmogenic right ventricular dysplasia 14 (ISO)

Experimental Liver Cirrhosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1,4-dioxane (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

acetaldehyde (ISO)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

butanal (ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

chrysene (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cytarabine (ISO)

DDE (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

Diisodecyl phthalate (ISO)

dimethyl sulfoxide (ISO)

dioxygen (ISO)

diuron (EXP)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

flusilazole (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

gentamycin (EXP)

glycidol (EXP)

graphene oxide (ISO)

GSK-J4 (ISO)

hexaconazole (ISO)

hydralazine (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

inulin (ISO)

iron dichloride (ISO)

lead diacetate (ISO)

levofloxacin (EXP)

Licochalcone B (ISO)

menadione (ISO)

methamphetamine (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

ozone (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resorcinol (ISO)

rotenone (EXP)

selenium atom (ISO)

sodium arsenite (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triadimefon (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

trovafloxacin (EXP)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

spliceosomal complex assembly (ISO,ISS)

Cellular Component

nucleus (IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Rsrp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	152,431,448 - 152,435,202 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	152,431,478 - 152,435,126 (+)	Ensembl				GRCr8
mRatBN7.2	5	147,147,774 - 147,151,523 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	147,147,784 - 147,151,523 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	149,848,500 - 149,852,227 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	151,619,934 - 151,623,673 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	151,604,742 - 151,608,469 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	153,260,930 - 153,264,669 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	153,260,930 - 153,264,669 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	157,029,893 - 157,033,632 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	153,698,946 - 153,702,685 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	145,559,973 - 145,563,712 (+)	NCBI		Celera
RGSC_v3.1	5	153,709,036 - 153,712,648 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

RSRP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	25,242,249 - 25,338,254 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	25,242,248 - 25,338,244 (-)	Ensembl			hg38	GRCh38
GRCh37	1	25,568,740 - 25,664,745 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	25,441,327 - 25,446,572 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	23,893,296 - 23,898,542 (-)	NCBI		Celera
Cytogenetic Map	1	p36.11	NCBI
HuRef	1	23,822,803 - 23,828,049 (-)	NCBI		HuRef
CHM1_1	1	25,682,804 - 25,688,050 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	25,078,510 - 25,174,547 (-)	NCBI		T2T-CHM13v2.0

Rsrp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	134,650,936 - 134,654,681 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	134,650,903 - 134,654,982 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	134,923,625 - 134,927,370 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	134,923,592 - 134,927,671 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	134,479,540 - 134,483,285 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	134,195,716 - 134,199,449 (+)	NCBI		MGSCv36	mm8
Celera	4	133,109,099 - 133,112,842 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	67.15	NCBI

Rsrp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	4,865,656 - 4,869,985 (-)	Ensembl
ChiLan1.0	NW_004955452	4,865,330 - 4,871,049 (-)	NCBI	ChiLan1.0	ChiLan1.0

RSRP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	201,686,519 - 201,691,816 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	200,784,456 - 200,789,729 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	24,440,889 - 24,446,165 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	25,415,172 - 25,420,438 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

RSRP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	74,545,114 - 74,549,840 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	74,545,264 - 74,549,832 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	71,117,695 - 71,122,440 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	75,105,021 - 75,109,772 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	75,105,054 - 75,109,767 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	71,928,358 - 71,933,070 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	72,934,749 - 72,939,500 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	73,939,291 - 73,944,034 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

RSRP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	82,850,949 - 82,854,270 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	82,850,947 - 82,861,578 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LOC103225354
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	107,454,761 - 107,460,356 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	107,455,194 - 107,460,062 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	8,902,344 - 8,907,946 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rsrp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	23,318,001 - 23,321,762 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rsrp1
41 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	368
Count of miRNA genes:	200
Interacting mature miRNAs:	243
Transcripts:	ENSRNOT00000023289
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	149642129	171146538	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	134369218	156289444	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	149805999	162987697	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	149661912	166600247	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

D5Got86

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	147,145,828 - 147,146,043 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	153,258,975 - 153,259,189	NCBI	Rnor6.0
Rnor_5.0	5	157,027,938 - 157,028,152	UniSTS	Rnor5.0
RGSC_v3.4	5	153,696,974 - 153,697,251	RGD	RGSC3.4
RGSC_v3.4	5	153,696,991 - 153,697,205	UniSTS	RGSC3.4
Celera	5	145,558,020 - 145,558,232	UniSTS
RGSC_v3.1	5	153,707,030 - 153,707,244	RGD
RH 3.4 Map	5	994.3	RGD
RH 3.4 Map	5	994.3	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH128747

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	147,151,167 - 147,151,320 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	153,264,314 - 153,264,466	NCBI	Rnor6.0
Rnor_5.0	5	157,033,277 - 157,033,429	UniSTS	Rnor5.0
RGSC_v3.4	5	153,702,330 - 153,702,482	UniSTS	RGSC3.4
Celera	5	145,563,357 - 145,563,509	UniSTS
RH 3.4 Map	5	994.2	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH124870

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	147,151,141 - 147,151,312 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	153,264,288 - 153,264,458	NCBI	Rnor6.0
Rnor_5.0	5	157,033,251 - 157,033,421	UniSTS	Rnor5.0
RGSC_v3.4	5	153,702,304 - 153,702,474	UniSTS	RGSC3.4
Celera	5	145,563,331 - 145,563,501	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005504497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010066425	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF282923	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP475626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB811984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO405856	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023289 ⟹ ENSRNOP00000023289

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	147,147,784 - 147,151,523 (+)	Ensembl
Rnor_6.0 Ensembl	5	153,260,930 - 153,264,669 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082184 ⟹ ENSRNOP00000072995

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	152,431,478 - 152,435,126 (+)	Ensembl
mRatBN7.2 Ensembl	5	147,147,799 - 147,151,433 (+)	Ensembl
Rnor_6.0 Ensembl	5	153,260,982 - 153,264,593 (+)	Ensembl

RefSeq Acc Id:

NM_001014193 ⟹ NP_001014215

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	152,431,463 - 152,435,202 (+)	NCBI
mRatBN7.2	5	147,147,784 - 147,151,523 (+)	NCBI
Rnor_6.0	5	153,260,930 - 153,264,669 (+)	NCBI
Rnor_5.0	5	157,029,893 - 157,033,632 (+)	NCBI
RGSC_v3.4	5	153,698,946 - 153,702,685 (+)	RGD
Celera	5	145,559,973 - 145,563,712 (+)	RGD

Sequence:

show sequence

GTCGCTGCGGACTTCAGTTCGCATCCGGACTTCGTCGGTGAAGGTTCCTCTGCTGTTTTGTCGG
TTGGAACGGGAACCTCGCCCGCTTAGGGTCCTGGTCACAGAGAAAGGTGCCCGCTAGGCCTCTC
TCGCCCTTGCGAGCGCTTCATCAGTTTAAGTCCCTAGACGTCGTTGCGTTCGCGGACGGAACCC
CGATCTGAGAAGGAAGTCATGTCTTCGGCCGCCGTGTCCAAGTATGTGAACGACATGTGGCCCG
GCTCTCCGCAGGAGAAAGCCTCGCCGTCCACCTCGGGCTCGGGCCGCTCCAGCCGCCTGTCTTC
GCGCTCCCGCAGCCGCTCTTCGTCCCGCAGCTCCAGACCCCACTCCCGCAGCTCCAGCCGCTCG
TCCTCGCGGAGCCATAGCCGGCCGCGGAGGAGCAGACGGTCCCGATCCCGATCCCGGTCCCGCA
GGCGCCACCAGCGCAAGTACCGGCGATACTCGCGGTCGTACTCACGCAGCCGATCGCGGTCCCG
CGGCCACCGCTACTACCGAGACAGCCGTTACGAGCAGCCGCGGAGGTACTACCAGTCGCCGTCG
CCCTACCGGTCCCGGAGCAGGTCGCGCTCCCGTGGGAGGTCCCATCACCGGAGGTCGTACTACG
CGATCACTCGAGGGCGGCGCTACTATGGCTTCGGCCGAACCGTGTACCCGGAGGATCGCCCCAG
GTGGCGGGAAAGATCCAGGACCAGGTCGCGCAGCAGGAGCAGAACCCCTTTTCGCCTGAGTGAG
AAAGATCGAATGGAGCTGCTAGAAATAGCAAAAGCCAACGCAGCAAAAGCTCTAGGAACAGCCA
ACTTTGACCTGCCAGCAAGTCTCCGTGCCAAGGAAGCAAGCCAGGGAGCTGTTTCCTGCAGTGG
GCCAAAGACGGAGCATTCAGAAAAGCAGACTGAAGTGGGAACTAAAAATGCCAGTGAGAAATCT
GCTGCTGCACAGAGAAACATAGCGTTCAGCTCTAATAATTCTGTAGCAAAGCCTCTAGAGAAAA
CAACGAAAGCTGCTGTTGAAGAGACGTCATCAGGATCACCAAAAATAGATAAGAAAAAAAGTCC
TTATGGACTGTGGATACCTGTCTAAAGGAAAACTAAGGGGTTGCCTAAAACTGCACTTTACTGA
GGGGTTCGTGTCCAGCATCAGCTCACCTGCCTGAGTAATCTCAGCAGTAAATGTGATTGAAATC
CATTACAGAAAGAGGCTTAATGGTGCCGTGTTCATGGGTGAGGTTTCTCTTGAAGATGTGAGGA
TACAGATGACCCAGAGAATTGCATACAGGTGGGGATCTTGTACATACCTGTAAGTATTGTATAG
TATCGCTTATATACAAAGGTGAATTTTTATAAAGACACAGTTGCAAACTGTATTTTGTATATTT
GTTAATAAACTTTTTGTCTTGATTTTTATGGATATGGAATGTGTCTGTCTACATCTGAAGAAGA
AACCCTTTCTGAAAACAGACAATACAGGATTTATGAATTCATA

hide sequence

RefSeq Acc Id:

XM_063288065 ⟹ XP_063144135

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	152,431,448 - 152,434,336 (+)	NCBI

RefSeq Acc Id:

XM_063288067 ⟹ XP_063144137

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	152,431,448 - 152,434,336 (+)	NCBI

RefSeq Acc Id:

XM_063288068 ⟹ XP_063144138

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	152,431,448 - 152,434,336 (+)	NCBI

RefSeq Acc Id:

XR_005504497

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	152,431,448 - 152,434,746 (+)	NCBI
mRatBN7.2	5	147,147,774 - 147,151,521 (+)	NCBI

RefSeq Acc Id:

XR_010066425

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	152,431,448 - 152,434,336 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014215	(Get FASTA)	NCBI Sequence Viewer
	XP_063144135	(Get FASTA)	NCBI Sequence Viewer
	XP_063144137	(Get FASTA)	NCBI Sequence Viewer
	XP_063144138	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85888	(Get FASTA)	NCBI Sequence Viewer
	EDL80741	(Get FASTA)	NCBI Sequence Viewer
	EDL80742	(Get FASTA)	NCBI Sequence Viewer
	EDL80743	(Get FASTA)	NCBI Sequence Viewer
	EDL80744	(Get FASTA)	NCBI Sequence Viewer
	EDL80745	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023289.5
	ENSRNOP00000072995.1
GenBank Protein	Q5U2S0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014215 ⟸ NM_001014193

- UniProtKB:

Q5U2S0 (UniProtKB/Swiss-Prot), A6IT40 (UniProtKB/TrEMBL), A6IT41 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSAAVSKYVNDMWPGSPQEKASPSTSGSGRSSRLSSRSRSRSSSRSSRPHSRSSSRSSSRSHS
RPRRSRRSRSRSRSRRRHQRKYRRYSRSYSRSRSRSRGHRYYRDSRYEQPRRYYQSPSPYRSRS
RSRSRGRSHHRRSYYAITRGRRYYGFGRTVYPEDRPRWRERSRTRSRSRSRTPFRLSEKDRMEL
LEIAKANAAKALGTANFDLPASLRAKEASQGAVSCSGPKTEHSEKQTEVGTKNASEKSAAAQRN
IAFSSNNSVAKPLEKTTKAAVEETSSGSPKIDKKKSPYGLWIPV

hide sequence

Ensembl Acc Id:

ENSRNOP00000072995 ⟸ ENSRNOT00000082184

Ensembl Acc Id:

ENSRNOP00000023289 ⟸ ENSRNOT00000023289

RefSeq Acc Id:	XP_063144135 ⟸ XM_063288065
- Peptide Label:	isoform X1
- UniProtKB:	A6IT44 (UniProtKB/TrEMBL), A6IT42 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063144137 ⟸ XM_063288067
- Peptide Label:	isoform X1
- UniProtKB:	A6IT44 (UniProtKB/TrEMBL), A6IT42 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063144138 ⟸ XM_063288068
- Peptide Label:	isoform X2
- UniProtKB:	A6IT44 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U2S0-F1-model_v2	AlphaFold	Q5U2S0	1-300	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694147

Promoter ID:

EPDNEW_R4672

Type:

single initiation site

Name:

Rsrp1_1

Description:

arginine and serine rich protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	153,260,945 - 153,261,005	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359529	AgrOrtholog
BioCyc Gene	G2FUF-39554	BioCyc
Ensembl Genes	ENSRNOG00000017309	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000023289.8	UniProtKB/Swiss-Prot
	ENSRNOT00000082184.2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7192402	IMAGE-MGC_LOAD
InterPro	RSRP1	UniProtKB/Swiss-Prot
KEGG Report	rno:362626	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94676	IMAGE-MGC_LOAD
NCBI Gene	362626	ENTREZGENE
PANTHER	ARGININE/SERINE-RICH PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR47622	UniProtKB/Swiss-Prot
Pfam	RSRP	UniProtKB/Swiss-Prot
PhenoGen	Rsrp1	PhenoGen
RatGTEx	ENSRNOG00000017309	RatGTEx
UniProt	A6IT40	ENTREZGENE, UniProtKB/TrEMBL
	A6IT41	ENTREZGENE, UniProtKB/TrEMBL
	A6IT42	ENTREZGENE, UniProtKB/TrEMBL
	A6IT44	ENTREZGENE, UniProtKB/TrEMBL
	Q5U2S0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-15	Rsrp1	arginine and serine rich protein 1	Rsrp1	arginine/serine-rich protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-03-13	Rsrp1	arginine/serine-rich protein 1	RGD1359529	similar to chromosome 1 open reading frame 63	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	RGD1359529	similar to chromosome 1 open reading frame 63			Symbol and Name updated	1299863	APPROVED
2005-07-29	LOC362626	similar to hypothetical protein dJ465N24.2.1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD