Advanced Search (OLGA)

Gene: Tacstd2 (tumor-associated calcium signal transducer 2) Rattus norvegicus

Analyze

Symbol:

Tacstd2

Name:

tumor-associated calcium signal transducer 2

RGD ID:

1359498

Description:

Predicted to be involved in several processes, including negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; and negative regulation of substrate adhesion-dependent cell spreading. Predicted to be located in basal plasma membrane and lateral plasma membrane. Predicted to be active in extracellular space and nucleus. Human ortholog(s) of this gene implicated in corneal dystrophy and gelatinous drop-like corneal dystrophy. Orthologous to human TACSTD2 (tumor associated calcium signal transducer 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC72570; parturition-related protein 1; Prp1; Trop2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	98,037,620 - 98,039,320 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	98,033,251 - 98,039,323 (-)	Ensembl				GRCr8
mRatBN7.2	4	96,707,950 - 96,709,650 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	96,707,951 - 96,709,650 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	101,963,680 - 101,965,380 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	97,738,651 - 97,740,351 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	96,165,839 - 96,167,539 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	98,341,187 - 98,342,887 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	98,341,188 - 98,342,887 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	163,126,801 - 163,128,501 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	97,803,151 - 97,804,851 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	91,374,254 - 91,375,954 (-)	NCBI		Celera
RGSC_v3.1	4	98,047,632 - 98,049,313 (-)	NCBI
Cytogenetic Map	4	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

corneal dystrophy (ISO)

endometriosis (ISO)

gelatinous drop-like corneal dystrophy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,1-dichloroethene (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,6-dimethoxyphenol (ISO)

2-palmitoylglycerol (ISO)

3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO)

6-propyl-2-thiouracil (EXP)

9-cis-retinoic acid (ISO)

afimoxifene (ISO)

all-trans-retinoic acid (ISO)

amphotericin B (ISO)

arsenous acid (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

Benzo[k]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butan-1-ol (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

choline (ISO)

chromium(6+) (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) chloride (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDE (ISO)

diarsenic trioxide (ISO)

diethyl phthalate (EXP)

diethylstilbestrol (ISO)

dimethylarsinous acid (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

ethanol (ISO)

folic acid (ISO)

furan (EXP)

furfural (ISO)

genistein (ISO)

gold atom (ISO)

gold(0) (ISO)

hexane (EXP)

hydrogen peroxide (ISO)

isobutanol (ISO)

isotretinoin (ISO)

ketamine (EXP)

L-methionine (ISO)

Licochalcone B (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

phenylmercury acetate (ISO)

poly(I:C) (ISO)

potassium chromate (ISO)

progesterone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sulforaphane (ISO)

testosterone (ISO)

tetrathiomolybdate(2-) (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

negative regulation of branching involved in ureteric bud morphogenesis (ISO,ISS)

negative regulation of cell motility (ISO,ISS)

negative regulation of epithelial cell migration (ISO,ISS)

negative regulation of ruffle assembly (ISO,ISS)

negative regulation of stress fiber assembly (ISO,ISS)

negative regulation of substrate adhesion-dependent cell spreading (ISO,ISS)

positive regulation of stem cell differentiation (IBA,ISO)

regulation of epithelial cell proliferation (ISO)

ureteric bud morphogenesis (ISO)

Cellular Component

basal plasma membrane (ISO,ISS)

extracellular space (IBA,ISO)

lateral plasma membrane (ISO,ISS)

membrane (IEA,ISO)

nucleus (IBA,ISO)

plasma membrane (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	Identification of the gene responsible for gelatinous drop-like corneal dystrophy.	Tsujikawa M, etal., Nat Genet. 1999 Apr;21(4):420-3.

Additional References at PubMed

PMID:9462726	PMID:19199708	PMID:21743029	PMID:22194864	PMID:23070813	PMID:23376485

Genomics

Comparative Map Data

Tacstd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	98,037,620 - 98,039,320 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	98,033,251 - 98,039,323 (-)	Ensembl				GRCr8
mRatBN7.2	4	96,707,950 - 96,709,650 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	96,707,951 - 96,709,650 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	101,963,680 - 101,965,380 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	97,738,651 - 97,740,351 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	96,165,839 - 96,167,539 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	98,341,187 - 98,342,887 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	98,341,188 - 98,342,887 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	163,126,801 - 163,128,501 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	97,803,151 - 97,804,851 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	91,374,254 - 91,375,954 (-)	NCBI		Celera
RGSC_v3.1	4	98,047,632 - 98,049,313 (-)	NCBI
Cytogenetic Map	4	q31	NCBI

TACSTD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	58,575,433 - 58,577,252 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	58,575,433 - 58,577,252 (-)	Ensembl			hg38	GRCh38
GRCh37	1	59,041,105 - 59,042,924 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	58,813,231 - 58,816,033 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	58,752,663 - 58,755,466	NCBI
Celera	1	57,324,947 - 57,327,018 (-)	NCBI		Celera
Cytogenetic Map	1	p32.1	NCBI
HuRef	1	57,151,670 - 57,153,741 (-)	NCBI		HuRef
CHM1_1	1	59,156,449 - 59,158,520 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	58,453,397 - 58,455,216 (-)	NCBI		T2T-CHM13v2.0

Tacstd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	67,511,043 - 67,512,806 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	67,511,046 - 67,512,780 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	67,534,059 - 67,535,822 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	67,534,062 - 67,535,796 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	67,484,053 - 67,485,816 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	67,463,640 - 67,465,374 (-)	NCBI		MGSCv36	mm8
Celera	6	69,652,700 - 69,654,464 (-)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI
cM Map	6	30.88	NCBI

Tacstd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955464	1,282,989 - 1,284,785 (+)	NCBI	ChiLan1.0	ChiLan1.0

TACSTD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	168,269,077 - 168,271,255 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	167,421,430 - 167,423,741 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	57,838,661 - 57,841,444 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	59,544,868 - 59,547,207 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	59,545,625 - 59,546,596 (-)	Ensembl			panPan2	panpan1.1

TACSTD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	51,122,469 - 51,123,753 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	51,187,934 - 51,189,787 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	51,303,042 - 51,304,084 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	5	51,252,727 - 51,254,573 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	51,198,006 - 51,199,866 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	51,481,572 - 51,483,437 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tacstd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	72,207,616 - 72,209,632 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	3,206,957 - 3,207,919 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936522	3,206,826 - 3,208,675 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TACSTD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	153,859,482 - 153,861,492 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	153,859,488 - 153,861,508 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	141,453,653 - 141,455,459 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TACSTD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	74,403,547 - 74,406,756 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	42,956,630 - 42,959,787 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tacstd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624862	1,721,030 - 1,722,780 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tacstd2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	77,089,669 - 77,091,375 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tacstd2
61 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	113
Count of miRNA genes:	90
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000010156
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	96731383	141731383	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	92406430	137406430	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	80212111	119233320	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	71647492	116647492	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
2317587	Eae26	Experimental allergic encephalomyelitis QTL 26			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	89986808	101226978	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	80216705	104243248	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	88883695	133883695	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	88883695	133883695	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	86058928	131411333	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	86583980	131583980	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat

Markers in Region

AI575674

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	96,708,041 - 96,708,228 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	98,341,279 - 98,341,465	NCBI	Rnor6.0
Rnor_5.0	4	163,126,893 - 163,127,079	UniSTS	Rnor5.0
RGSC_v3.4	4	97,803,243 - 97,803,429	UniSTS	RGSC3.4
Celera	4	91,374,346 - 91,374,532	UniSTS
RH 3.4 Map	4	607.7	UniSTS
Cytogenetic Map	4	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	10	11	104	68	78	47	46	47	6	225	74	11	84	80	81	31	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY185508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010156 ⟹ ENSRNOP00000010156

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	96,707,951 - 96,709,650 (-)	Ensembl
Rnor_6.0 Ensembl	4	98,341,188 - 98,342,887 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000126716 ⟹ ENSRNOP00000106672

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	98,033,251 - 98,039,323 (-)	Ensembl

RefSeq Acc Id:

NM_001009540 ⟹ NP_001009540

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	98,037,620 - 98,039,320 (-)	NCBI
mRatBN7.2	4	96,707,950 - 96,709,650 (-)	NCBI
Rnor_6.0	4	98,341,187 - 98,342,887 (-)	NCBI
Rnor_5.0	4	163,126,801 - 163,128,501 (-)	NCBI
RGSC_v3.4	4	97,803,151 - 97,804,851 (-)	RGD
Celera	4	91,374,254 - 91,375,954 (-)	RGD

Sequence:

show sequence

AGTCGCCTGCAGTATCCTACCCAACCTGATCCTTCAGAATCCCTGCCCTTGGTCTGTAGTTGTA
GGTCCGTTCTATTCTATACCACCATGGCGAGGGGCTTGGATCTAGCACCGCTGCTACTGCTACT
GCTGGCGATGGTGGCCGGCTTTTGCACGGCCCAGATCAACTGCACATGCCCTACCAACAAGATG
ACCGTCTGCAACTCTAATGGCCCAGGTGGGGTCTGCCAATGTCGGGCAATCGGCTCGCAGGTGT
TGGTCGACTGCTCCACGCTAACTTCCAAGTGCCTGCTACTCAAGGCGCGCATGAGCGCCCGAAA
GAGCAGCCGCAGACTGGTGAATCCGAGCGAGCACGCGATCTTGGACAACGATGGCCTCTACGAC
CCGGAGTGTGACGACAAGGGCCGCTTCAAGGCGCGCCAGTGCAACCAGACCTCGGTGTGCTGGT
GCGTAAACTCGGTGGGCGTGCGCCGAACGGACAAGGGAGACCAGAGCCTGCGCTGCGACGAAGT
GGTGCGAACCCACCACATCCTCATTGAGTTGCGCCACCGCCCGACAGACCGAGCCTTCAACCAC
TCTGACCTAGACTCCGAGCTGCGGCGGCTCTTCAAGGAACGCTACAAGCTGCACCCCAGCTTCC
TGGCCGCGGTGCACTACGAAGAGCCCACCATCCAGATCGAGCTGCAGCAGAACGCGTCACAGAA
GGGCCTGAGAGACGTGGACATCGCTGACGCCGCCTACTACTTCGAAAGGGACATCAAAGGCGAG
TCACTGTTCGTGGGCCGTCGCGGCCTGGACGTGCAGGTGCGTGGGGAGCCCCTGCATGTGGAGC
GGACTCTCATCTACTACCTGGACGAGAAGCCCCCCCAGTTCTCCATGAAGCGCCTCACCACCGG
CCTCATTGCCGTCATCGCTGTCGTCGCGGTGGCACTAGTGGCCGGTGTGGTGGTCTTGGTGGTC
ACCAACCGGAGGAAATCAGGAAAATACAAAAAGGTGGAGCTTAAGGAGCTAGGGGAGATGAGAA
GCGAACCTAGCTTGTAGATTTCCCCGGGCTTCCTTGGCACCTCAGACCAAATGTGTTGGCCTGT
TGATTCTTAGCCAGGAGGTAATTTTCCTCCCAGCTGTGACCTCTTCCTTCTCTCTCCACAAACA
AGTTCCCTAGATGCTGAGCTCAGGTCACCTCCTCGCCCTTGATTTTGAAGGACGCATTTCTGAA
ATTCCTTATCCAGTCTCTCAAAACCTGACCCGGAGGGTTAAGCAAAGACTGGCTTGTGCCAGGC
AGCCCAGTCGTTTCCCAGAGACGTGAATCTACCCAAAGACTTAAAAAACGGTTTGAAATGGGAA
CGCAGCTCTTTTGCTGTCCTGGGTTGTTGGCGAACCATTCACTCCCTGCCTCACAACCTTCAGG
AAAGGAAGAACTAACTGATCCTGTGCAGTGTTCCTCTGCCATCGTTCATATGGAATAAAAGGCG
TGTCCGACGTCTGCAGTCATTTTAAATGGCTTTGTTGGACTGCATCTATTTTTCTGCCTGCCCC
TGATGTAGCTGATACTAGAAAGTTTTCTTTTGTAAAGTGTTTGTACAGATGCGTCTTTGATAAT
GCTGCTGGTTTTTTTAAAGCAACAACTCAAGTTTAATAAAATATGGGAAAGGCACACCTAAAAA
GATAGGCTGTGTAAATATTCCCTCCAGATTTATATCAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009540	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60519	(Get FASTA)	NCBI Sequence Viewer
	AAO67351	(Get FASTA)	NCBI Sequence Viewer
	EDL91571	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000106672
GenBank Protein	Q6P9Z6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001009540 ⟸ NM_001009540
- Peptide Label:	precursor
- UniProtKB:	Q6K0P4 (UniProtKB/Swiss-Prot), Q6P9Z6 (UniProtKB/Swiss-Prot), A0A0G2JSJ1 (UniProtKB/TrEMBL), A6KF53 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARGLDLAPLLLLLLAMVAGFCTAQINCTCPTNKMTVCNSNGPGGVCQCRAIGSQVLVDCSTLT SKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVR RTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEE PTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLD EKPPQFSMKRLTTGLIAVIAVVAVALVAGVVVLVVTNRRKSGKYKKVELKELGEMRSEPSL hide sequence

Ensembl Acc Id:

ENSRNOP00000010156 ⟸ ENSRNOT00000010156

Ensembl Acc Id:

ENSRNOP00000106672 ⟸ ENSRNOT00000126716

Protein Domains

Thyroglobulin type-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P9Z6-F1-model_v2	AlphaFold	Q6P9Z6	1-317	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693104

Promoter ID:

EPDNEW_R3628

Type:

single initiation site

Name:

Tacstd2_1

Description:

tumor-associated calcium signal transducer 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	98,342,887 - 98,342,947	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359498	AgrOrtholog
BioCyc Gene	G2FUF-44558	BioCyc
Ensembl Genes	ENSRNOG00000007740	Ensembl
	ENSRNOG00000078917	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000126716	ENTREZGENE
Gene3D-CATH	4.10.800.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5597863	IMAGE-MGC_LOAD
InterPro	EPCAM-Trop-2_C	UniProtKB/Swiss-Prot
	EPCAM/Trop-2	UniProtKB/Swiss-Prot
	EpCAM_N	UniProtKB/Swiss-Prot
	Thyroglobulin_1	UniProtKB/Swiss-Prot
	Thyroglobulin_1_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:494343	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72570	IMAGE-MGC_LOAD
NCBI Gene	494343	ENTREZGENE
PANTHER	PTHR14168	UniProtKB/Swiss-Prot
	TUMOR-ASSOCIATED CALCIUM SIGNAL TRANSDUCER 2	UniProtKB/Swiss-Prot
Pfam	EPCAM-Trop-2_C	UniProtKB/Swiss-Prot
	EpCAM_N	UniProtKB/Swiss-Prot
	Thyroglobulin_1	UniProtKB/Swiss-Prot
PhenoGen	Tacstd2	PhenoGen
PROSITE	THYROGLOBULIN_1_1	UniProtKB/Swiss-Prot
	THYROGLOBULIN_1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007740	RatGTEx
	ENSRNOG00000078917	RatGTEx
SMART	SM00211	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57610	UniProtKB/Swiss-Prot
UniProt	A0A0G2JSJ1	ENTREZGENE
	A0ABK0L8S5_RAT	UniProtKB/TrEMBL
	A6KF53	ENTREZGENE, UniProtKB/TrEMBL
	Q6K0P4	ENTREZGENE
	Q6P9Z6	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q6K0P4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-11-17	Tacstd2	tumor-associated calcium signal transducer 2			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Tacstd2	tumor-associated calcium signal transducer 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM