Symbol:
Uxt
Name:
ubiquitously-expressed, prefoldin-like chaperone
RGD ID:
1359326
Description:
Predicted to enable beta-tubulin binding activity; chromatin binding activity; and transcription corepressor activity. Predicted to be involved in centrosome cycle and negative regulation of transcription by RNA polymerase II. Predicted to be located in centrosome; cytoplasm; and nucleus. Predicted to be part of RPAP3/R2TP/prefoldin-like complex and mediator complex. Predicted to be active in chromatin. Orthologous to human UXT (ubiquitously expressed prefoldin like chaperone); INTERACTS WITH 6-propyl-2-thiouracil; acetamide; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC105797; similar to ubiquitously-expressed transcript isoform 1; ubiquitously expressed transcript
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
UXT (ubiquitously expressed prefoldin like chaperone) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Uxt (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Uxt (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
UXT (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
UXT (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Uxt (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
UXT (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
UXT (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Uxt (ubiquitously expressed prefoldin like chaperone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
UXT (ubiquitously expressed prefoldin like chaperone)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Uxt (ubiquitously expressed prefoldin like chaperone)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
uxt (ubiquitously-expressed, prefoldin-like chaperone)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F35H10.6
Alliance
DIOPT (InParanoid|OrthoFinder)
Drosophila melanogaster (fruit fly):
l(2)35Cc
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 3,679,630 - 3,691,944 (+) NCBI GRCr8 mRatBN7.2 X 1,126,110 - 1,138,670 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 1,126,162 - 1,138,663 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 1,154,446 - 1,166,501 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 4,630,138 - 4,642,193 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 950,682 - 962,723 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 1,275,402 - 1,287,781 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 1,275,612 - 1,287,512 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 2,090,439 - 2,102,802 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 12,616,439 - 12,628,479 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 12,621,996 - 12,634,035 (-) NCBI Celera X 1,695,268 - 1,707,300 (+) NCBI Celera Cytogenetic Map X q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Uxt Rat 1,2-dimethylhydrazine multiple interactions ISO Uxt (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of UXT mRNA CTD PMID:22206623 Uxt Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO UXT (Homo sapiens) 6480464 Metribolone promotes the reaction [UXT protein binds to ATR promoter] more ... CTD PMID:19318562 Uxt Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one affects response to substance ISO UXT (Homo sapiens) 6480464 UXT protein affects the susceptibility to Metribolone CTD PMID:19318562 Uxt Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Uxt (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of UXT mRNA CTD PMID:21570461 Uxt Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Uxt (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of UXT mRNA CTD PMID:25975270 Uxt Rat 4,4'-diaminodiphenylmethane affects expression ISO Uxt (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of UXT mRNA CTD PMID:18648102 Uxt Rat 4,4'-sulfonyldiphenol increases expression ISO Uxt (Mus musculus) 6480464 bisphenol S results in increased expression of UXT mRNA CTD PMID:39298647 Uxt Rat 5-fluorouracil increases expression ISO UXT (Homo sapiens) 6480464 Fluorouracil results in increased expression of UXT protein CTD PMID:15585135 and PMID:16803524 Uxt Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of UXT mRNA CTD PMID:30047161 Uxt Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of UXT mRNA CTD PMID:31881176 Uxt Rat aflatoxin B1 decreases methylation ISO UXT (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of UXT gene CTD PMID:27153756 Uxt Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of UXT mRNA CTD PMID:30047161 Uxt Rat arsenite(3-) multiple interactions ISO UXT (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to UXT mRNA] CTD PMID:32406909 Uxt Rat benzo[a]pyrene affects methylation ISO UXT (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of UXT promoter CTD PMID:27901495 Uxt Rat bicalutamide affects response to substance ISO UXT (Homo sapiens) 6480464 UXT protein affects the susceptibility to bicalutamide CTD PMID:19318562 Uxt Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of UXT mRNA CTD PMID:25181051 Uxt Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of UXT mRNA CTD PMID:34947998 Uxt Rat bleomycin A5 decreases expression ISO UXT (Homo sapiens) 6480464 bleomycetin results in decreased expression of UXT mRNA CTD PMID:21040473 Uxt Rat cadmium dichloride increases expression ISO UXT (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of UXT mRNA CTD PMID:38568856 Uxt Rat carbon nanotube increases expression ISO Uxt (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of UXT mRNA CTD PMID:25554681 Uxt Rat cobalt dichloride decreases expression ISO UXT (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of UXT mRNA CTD PMID:19376846 Uxt Rat cyclosporin A increases expression ISO UXT (Homo sapiens) 6480464 Cyclosporine results in increased expression of UXT mRNA CTD PMID:25562108 and PMID:27989131 Uxt Rat disodium selenite increases expression ISO UXT (Homo sapiens) 6480464 Sodium Selenite results in increased expression of UXT mRNA CTD PMID:18175754 Uxt Rat epoxiconazole increases expression ISO Uxt (Mus musculus) 6480464 epoxiconazole results in increased expression of UXT mRNA CTD PMID:35436446 Uxt Rat folic acid multiple interactions ISO Uxt (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of UXT mRNA CTD PMID:22206623 Uxt Rat furan increases methylation EXP 6480464 furan results in increased methylation of UXT gene CTD PMID:22079235 Uxt Rat glycidyl methacrylate increases expression ISO UXT (Homo sapiens) 6480464 glycidyl methacrylate results in increased expression of UXT protein CTD PMID:36641056 Uxt Rat hydroxychloroquine increases expression ISO Uxt (Mus musculus) 6480464 Hydroxychloroquine results in increased expression of UXT mRNA CTD PMID:25321315 Uxt Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of UXT mRNA CTD PMID:30467583 Uxt Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of UXT mRNA CTD PMID:30047161 Uxt Rat methotrexate increases mutagenesis ISO Uxt (Mus musculus) 6480464 Methotrexate results in increased mutagenesis of UXT gene CTD PMID:22806879 Uxt Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of UXT mRNA CTD PMID:18417182 Uxt Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of UXT mRNA CTD PMID:33387578 Uxt Rat pirinixic acid increases expression ISO Uxt (Mus musculus) 6480464 pirinixic acid results in increased expression of UXT mRNA CTD PMID:23811191 Uxt Rat propiconazole increases expression ISO Uxt (Mus musculus) 6480464 propiconazole results in increased expression of UXT mRNA CTD PMID:21278054 Uxt Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of UXT mRNA CTD PMID:30047161 Uxt Rat silver atom increases expression ISO Uxt (Mus musculus) 6480464 Silver results in increased expression of UXT mRNA CTD PMID:27131904 Uxt Rat silver(0) increases expression ISO Uxt (Mus musculus) 6480464 Silver results in increased expression of UXT mRNA CTD PMID:27131904 Uxt Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of UXT mRNA CTD PMID:30047161 Uxt Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of UXT mRNA CTD PMID:34492290 Uxt Rat titanium dioxide increases expression ISO Uxt (Mus musculus) 6480464 titanium dioxide results in increased expression of UXT mRNA CTD PMID:27760801 Uxt Rat titanium dioxide decreases methylation ISO Uxt (Mus musculus) 6480464 titanium dioxide results in decreased methylation of UXT promoter alternative form CTD PMID:35295148 Uxt Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of UXT mRNA CTD PMID:33387578 Uxt Rat triphenyl phosphate affects expression ISO UXT (Homo sapiens) 6480464 triphenyl phosphate affects the expression of UXT mRNA CTD PMID:37042841 Uxt Rat triptonide affects expression ISO Uxt (Mus musculus) 6480464 triptonide affects the expression of UXT mRNA CTD PMID:33045310 Uxt Rat tungsten increases expression ISO Uxt (Mus musculus) 6480464 Tungsten results in increased expression of UXT mRNA CTD PMID:30912803 Uxt Rat valproic acid decreases expression ISO UXT (Homo sapiens) 6480464 Valproic Acid results in decreased expression of UXT mRNA CTD PMID:23179753 Uxt Rat valproic acid affects expression ISO UXT (Homo sapiens) 6480464 Valproic Acid affects the expression of UXT mRNA CTD PMID:25979313 Uxt Rat valproic acid decreases methylation ISO UXT (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of UXT gene CTD PMID:29154799
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
GOA pipeline
RGD automated data pipeline
3.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
5.
Cloning and characterization of UXT, a novel gene in human Xp11, which is widely and abundantly expressed in tumor tissue.
Schroer A, etal., Genomics 1999 Mar 15;56(3):340-3.
6.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Uxt Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 3,679,630 - 3,691,944 (+) NCBI GRCr8 mRatBN7.2 X 1,126,110 - 1,138,670 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 1,126,162 - 1,138,663 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 1,154,446 - 1,166,501 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 4,630,138 - 4,642,193 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 950,682 - 962,723 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 1,275,402 - 1,287,781 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 1,275,612 - 1,287,512 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 2,090,439 - 2,102,802 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 12,616,439 - 12,628,479 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 12,621,996 - 12,634,035 (-) NCBI Celera X 1,695,268 - 1,707,300 (+) NCBI Celera Cytogenetic Map X q11 NCBI
UXT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 47,651,796 - 47,659,180 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 47,651,796 - 47,659,180 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 47,511,195 - 47,518,579 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 47,396,139 - 47,403,504 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 47,267,449 - 47,274,770 NCBI Celera X 51,706,458 - 51,713,823 (-) NCBI Celera Cytogenetic Map X p11.23 NCBI HuRef X 45,223,944 - 45,231,332 (-) NCBI HuRef CHM1_1 X 47,542,327 - 47,549,715 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 47,061,699 - 47,069,083 (-) NCBI T2T-CHM13v2.0
Uxt Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 20,818,162 - 20,828,259 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 20,807,961 - 20,828,256 (-) Ensembl GRCm39 Ensembl GRCm38 X 20,951,665 - 20,962,017 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 20,941,722 - 20,962,017 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 20,528,791 - 20,539,104 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 20,108,624 - 20,118,937 (-) NCBI MGSCv36 mm8 Celera X 19,085,804 - 19,096,117 (-) NCBI Celera Cytogenetic Map X A1.3 NCBI cM Map X 16.46 NCBI
Uxt Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955516 420,616 - 430,134 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955516 421,402 - 429,804 (+) NCBI ChiLan1.0 ChiLan1.0
UXT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 49,278,273 - 49,285,734 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 49,281,645 - 49,289,111 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 40,087,712 - 40,095,164 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 47,983,770 - 47,991,169 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 47,983,770 - 47,991,148 (-) Ensembl panpan1.1 panPan2
UXT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 41,271,908 - 41,280,433 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 41,271,908 - 41,280,340 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 15,646,536 - 15,655,076 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 41,405,725 - 41,413,955 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 41,405,719 - 41,413,934 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 41,393,272 - 41,401,810 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 41,381,544 - 41,390,081 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 41,474,238 - 41,482,772 (-) NCBI UU_Cfam_GSD_1.0
Uxt Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 33,577,677 - 33,587,087 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936502 13,418,403 - 13,427,767 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936502 13,419,520 - 13,427,777 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UXT Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 42,176,145 - 42,184,079 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 42,176,142 - 42,184,131 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 47,294,749 - 47,302,738 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UXT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 44,828,836 - 44,836,433 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 44,828,841 - 44,835,985 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666076 10,083,180 - 10,090,625 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Uxt
.
Predicted Target Of
Count of predictions: 170 Count of miRNA genes: 116 Interacting mature miRNAs: 121 Transcripts: ENSRNOT00000013476 Prediction methods: Microtar, Miranda, Pita, Rnahybrid Result types: miRGate_prediction
731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat
RH142345
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 X 3,681,887 - 3,682,316 (+) Marker Load Pipeline mRatBN7.2 X 1,128,345 - 1,128,774 (+) MAPPER mRatBN7.2 Rnor_6.0 X 1,277,596 - 1,278,024 NCBI Rnor6.0 Rnor_5.0 X 2,092,617 - 2,093,045 UniSTS Rnor5.0 RGSC_v3.4 X 12,626,067 - 12,626,495 UniSTS RGSC3.4 Celera X 1,697,252 - 1,697,680 UniSTS RH 3.4 Map 10 422.7 UniSTS Cytogenetic Map X q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013476 ⟹ ENSRNOP00000013476
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 1,126,162 - 1,138,663 (+) Ensembl Rnor_6.0 Ensembl X 1,275,612 - 1,287,512 (+) Ensembl
RefSeq Acc Id:
NM_001006982 ⟹ NP_001006983
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 3,679,904 - 3,691,944 (+) NCBI mRatBN7.2 X 1,126,362 - 1,138,403 (+) NCBI Rnor_6.0 X 1,275,612 - 1,287,514 (+) NCBI Rnor_5.0 X 2,090,439 - 2,102,802 (+) NCBI RGSC_v3.4 X 12,616,439 - 12,628,479 (-) RGD Celera X 1,695,268 - 1,707,300 (+) RGD
Sequence:
CACATAATGGCGACGCCCCCGAAACGGCGGGCCTTGGATACGGTGGGGGAGAAAGTGCTGCGGTATGAGGCCTTTATCAGTGACGTACTGCAGCGAGACTTGCAAAAGGTACTGGACCATCGAGACAA
hide sequence
RefSeq Acc Id:
XM_006256611 ⟹ XP_006256673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 3,679,630 - 3,691,944 (+) NCBI mRatBN7.2 X 1,126,110 - 1,138,670 (+) NCBI Rnor_6.0 X 1,275,402 - 1,287,781 (+) NCBI Rnor_5.0 X 2,090,439 - 2,102,802 (+) NCBI
Sequence:
GCCGGAAGCCGCGGTTCGTTATAACAGTTATTGCTGGTGGCCCCTAGGTGAACGTCGCGGTTGC
hide sequence
RefSeq Acc Id:
XM_063279881 ⟹ XP_063135951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 3,679,912 - 3,691,944 (+) NCBI
RefSeq Acc Id:
XM_063279882 ⟹ XP_063135952
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 3,679,709 - 3,691,944 (+) NCBI
RefSeq Acc Id:
NP_001006983 ⟸ NM_001006982
- UniProtKB:
Q63ZY7 (UniProtKB/Swiss-Prot), A6JZQ2 (UniProtKB/TrEMBL)
- Sequence:
MATPPKRRALDTVGEKVLRYEAFISDVLQRDLQKVLDHRDKVYEQLSVYLQLRNVIERLQETNHSELYMQVDLGCNFFVDTMVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSDSLTKDS
hide sequence
RefSeq Acc Id:
XP_006256673 ⟸ XM_006256611
- Peptide Label:
isoform X2
- UniProtKB:
Q63ZY7 (UniProtKB/Swiss-Prot), A6JZQ2 (UniProtKB/TrEMBL)
- Sequence:
MATPPKRRALDTVGEKVLRYEAFISDVLQRDLQKVLDHRDKVYEQLSVYLQLRNVIERLQETNH
hide sequence
Ensembl Acc Id:
ENSRNOP00000013476 ⟸ ENSRNOT00000013476
RefSeq Acc Id:
XP_063135952 ⟸ XM_063279882
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063135951 ⟸ XM_063279881
- Peptide Label:
isoform X1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-12-06
Uxt
ubiquitously-expressed, prefoldin-like chaperone
Uxt
ubiquitously expressed transcript
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Uxt
ubiquitously expressed transcript
MGC105797
similar to ubiquitously-expressed transcript isoform 1
Symbol and Name updated
1299863 APPROVED
2005-07-29
MGC105797
similar to ubiquitously-expressed transcript isoform 1
Symbol and Name status set to provisional
70820 PROVISIONAL
