Advanced Search (OLGA)

Gene: Gnb4 (G protein subunit beta 4) Rattus norvegicus

Analyze

Symbol:

Gnb4

Name:

G protein subunit beta 4

RGD ID:

1359321

Description:

Predicted to enable signaling receptor complex adaptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in cell body. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease dominant intermediate F. Orthologous to human GNB4 (G protein subunit beta 4); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G-protein beta 4 subunit; guanine nucleotide binding protein (G protein), beta 4; guanine nucleotide binding protein (G protein), beta polypeptide 4; guanine nucleotide binding protein beta 4 subunit; guanine nucleotide binding protein, beta 4; guanine nucleotide-binding protein subunit beta-4; guanine nucleotide-binding protein subunit beta-4-like; LOC103691541; transducin beta chain 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNB4 (G protein subunit beta 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Gnb4 (guanine nucleotide binding protein (G protein), beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gnb4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNB4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNB4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gnb4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNB4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNB4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gnb4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gnb4 (G protein subunit beta 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HTRA4 (HtrA serine peptidase 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GNB4 (G protein subunit beta 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GNB4 (G protein subunit beta 4)	Alliance	DIOPT (HGNC\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gnb4 (guanine nucleotide binding protein (G protein), beta 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnb4a (guanine nucleotide binding protein (G protein), beta polypeptide 4a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	gnb4a (guanine nucleotide binding protein (G protein), beta polypeptide 4a)	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnb4b (guanine nucleotide binding protein (G protein), beta polypeptide 4b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	gpb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpb-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Gbeta13F	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Gbeta13F	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	STE4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	STE4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gnb4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	gnb4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	117,289,112 - 117,329,050 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	117,293,284 - 117,328,945 (-)	Ensembl				GRCr8
mRatBN7.2	2	115,360,746 - 115,400,680 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	115,364,918 - 115,400,579 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	121,978,648 - 122,014,835 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	120,091,274 - 120,127,462 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	114,792,415 - 114,829,063 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	118,978,965 - 119,007,877 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	118,978,973 - 119,007,835 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	138,634,556 - 138,658,879 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	118,791,192 - 118,827,413 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	110,474,964 - 110,510,249 (-)	NCBI		Celera
RGSC_v3.1	2	118,736,153 - 118,772,375 (-)	NCBI
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

Charcot-Marie-Tooth disease (ISO)

Charcot-Marie-Tooth disease dominant intermediate F (ISO)

Colorectal Neoplasms (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-adrenaline (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

barium(0) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

cannabidiol (ISO)

cannabigerol (ISO)

CGP 52608 (ISO)

cobalt dichloride (ISO)

cocaine (ISO)

copper atom (ISO)

copper(0) (ISO)

doxorubicin (ISO)

ethanol (EXP)

fluoranthene (ISO)

folic acid (ISO)

gentamycin (EXP)

glyphosate (EXP,ISO)

ivermectin (ISO)

lead diacetate (ISO)

manganese(II) chloride (EXP)

methylmercury chloride (ISO)

paracetamol (EXP)

PCB138 (EXP)

raloxifene (ISO)

resveratrol (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

valproic acid (EXP,ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IBA)

signal transduction (IEA)

substantia nigra development (ISO)

Cellular Component

cell body (IDA)

cytoplasm (IBA)

heterotrimeric G-protein complex (IBA,ISO)

synapse (ISO)

Molecular Function

protein binding (ISO)

protein-containing complex binding (ISO)

signaling receptor complex adaptor activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Distribution of heterotrimeric G-protein beta and gamma subunits in the rat brain.	Betty M, etal., Neuroscience 1998 Jul;85(2):475-86.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Immunohistochemical localization of G protein beta1, beta2, beta3, beta4, beta5, and gamma3 subunits in the adult rat brain.	Liang JJ, etal., J Neurochem. 1998 Jul;71(1):345-55.
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:17634366	PMID:17897319	PMID:21700703	PMID:22711958	PMID:22926577	PMID:23209302	PMID:23533145	PMID:29476059

Genomics

Comparative Map Data

Gnb4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	117,289,112 - 117,329,050 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	117,293,284 - 117,328,945 (-)	Ensembl				GRCr8
mRatBN7.2	2	115,360,746 - 115,400,680 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	115,364,918 - 115,400,579 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	121,978,648 - 122,014,835 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	120,091,274 - 120,127,462 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	114,792,415 - 114,829,063 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	118,978,965 - 119,007,877 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	118,978,973 - 119,007,835 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	138,634,556 - 138,658,879 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	118,791,192 - 118,827,413 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	110,474,964 - 110,510,249 (-)	NCBI		Celera
RGSC_v3.1	2	118,736,153 - 118,772,375 (-)	NCBI
Cytogenetic Map	2	q24	NCBI

GNB4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	179,396,088 - 179,527,798 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	179,396,088 - 179,451,647 (-)	Ensembl			hg38	GRCh38
GRCh37	3	179,113,876 - 179,169,258 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	180,596,570 - 180,652,065 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	180,599,703 - 180,652,073	NCBI
Celera	3	177,544,885 - 177,600,385 (-)	NCBI		Celera
Cytogenetic Map	3	q26.33	NCBI
HuRef	3	176,517,044 - 176,573,247 (-)	NCBI		HuRef
CHM1_1	3	179,076,983 - 179,132,490 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	182,199,923 - 182,331,637 (-)	NCBI		T2T-CHM13v2.0

Gnb4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	32,632,736 - 32,670,813 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	32,634,481 - 32,670,734 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	32,578,587 - 32,616,673 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	32,580,332 - 32,616,585 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	32,482,450 - 32,515,457 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	32,775,075 - 32,808,084 (-)	NCBI		MGSCv36	mm8
Celera	3	32,493,778 - 32,526,744 (-)	NCBI		Celera
Cytogenetic Map	3	A3	NCBI
cM Map	3	15.78	NCBI

Gnb4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	8,599,862 - 8,626,039 (-)	Ensembl
ChiLan1.0	NW_004955420	8,601,188 - 8,626,036 (-)	NCBI	ChiLan1.0	ChiLan1.0

GNB4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	177,264,665 - 177,320,039 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	177,269,382 - 177,324,856 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	176,428,475 - 176,483,905 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	184,601,229 - 184,630,913 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	184,601,229 - 184,630,913 (-)	Ensembl			panPan2	panpan1.1

GNB4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	12,818,063 - 12,849,822 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	12,822,104 - 12,876,865 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	16,961,214 - 17,020,002 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	12,715,666 - 12,775,264 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	12,715,668 - 12,775,220 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	12,767,432 - 12,826,680 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	12,750,008 - 12,809,317 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	12,989,502 - 13,048,778 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gnb4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	109,490,033 - 109,530,391 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936566	3,690,316 - 3,732,814 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936566	3,690,338 - 3,732,814 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNB4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	117,436,673 - 117,513,392 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	117,442,594 - 117,513,387 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	126,563,361 - 126,607,562 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNB4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	9,979,262 - 10,034,181 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	10,006,422 - 10,032,615 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666063	18,860,979 - 18,919,665 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gnb4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	57,161,696 - 57,208,557 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	57,155,279 - 57,208,563 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gnb4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	122,378,758 - 122,416,578 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gnb4
250 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	41
Interacting mature miRNAs:	43
Transcripts:	ENSRNOT00000014871
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	105628029	150628029	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
2317886	Alcrsp23	Alcohol response QTL 23	2.4	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	95142371	140142371	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	100807373	145807373	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	106869825	151869825	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
7488933	Bp368	Blood pressure QTL 368		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	104957381	149957381	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	114032149	150226270	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	116804572	161804572	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013910	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005500258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF022085	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY552804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120490	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014871 ⟹ ENSRNOP00000014871

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	117,293,284 - 117,309,276 (-)	Ensembl
mRatBN7.2 Ensembl	2	115,364,918 - 115,380,910 (-)	Ensembl
Rnor_6.0 Ensembl	2	118,978,973 - 118,989,127 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087803 ⟹ ENSRNOP00000074669

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	117,293,284 - 117,328,945 (-)	Ensembl
mRatBN7.2 Ensembl	2	115,364,918 - 115,400,579 (-)	Ensembl
Rnor_6.0 Ensembl	2	118,979,362 - 119,007,835 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113393 ⟹ ENSRNOP00000077504

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	117,303,410 - 117,328,945 (-)	Ensembl
mRatBN7.2 Ensembl	2	115,375,044 - 115,400,579 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172178 ⟹ ENSRNOP00000106318

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	117,293,284 - 117,312,553 (-)	Ensembl

RefSeq Acc Id:

NM_001013910 ⟹ NP_001013932

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	117,293,276 - 117,328,945 (-)	NCBI
mRatBN7.2	2	115,364,910 - 115,400,579 (-)	NCBI
Rnor_6.0	2	118,978,965 - 119,007,877 (-)	NCBI
Rnor_5.0	2	138,634,556 - 138,658,879 (-)	NCBI
RGSC_v3.4	2	118,791,192 - 118,827,413 (-)	RGD
Celera	2	110,474,964 - 110,510,249 (-)	RGD

Sequence:

show sequence

CAGCAGCAGCGCGGTGGTGGCGGCCAGGCTCCAGCTCTTCACTTGAGACTCCGGAGGGAAGCAG
CCACACAGGATGAGTGAGCTGGAGCAGCTGAGGCAGGAGGCTGAACAGCTCCGGAATCAGATCC
AGGATGCTCGGAAGGCCTGCAACGATGCCACACTGGTTCAGATCACGTCTAATATGGACTCCGT
GGGCCGAATACAAATGCGAACAAGGCGCACGCTGCGCGGCCACCTCGCCAAGATCTACGCCATG
CACTGGGGATACGATTCCAGGCTACTAGTCAGTGCTTCCCAAGATGGAAAATTAATTATTTGGG
ATAGCTATACAACAAATAAGATGCACGCCATCCCGCTGAGGTCCTCCTGGGTCATGACCTGTGC
CTATGCCCCGTCTGGGAACTACGTAGCCTGTGGAGGCTTGGACAACATCTGCTCCATATACAAC
CTGAAGACTCGTGAGGGGAACGTGAGAGTGAGCCGGGAGCTGCCAGGGCACACAGGCTACTTGT
CCTGCTGCCGATTCTTAGATGACGGACAAATCATTACAAGTTCTGGAGACACGACTTGTGCTTT
GTGGGACATCGAGACCGGACAGCAGACGACCACCTTCACAGGACACTCGGGGGACGTGATGAGC
CTCTCACTGAGTCCTGACTTGAAGACCTTTGTTTCTGGTGCTTGCGATGCATCTTCAAAACTGT
GGGATATCCGAGACGGGATGTGTAGACAGTCTTTCACAGGACACATCTCAGACATCAATGCTGT
CAGCTTCTTCCCGAGTGGATATGCCTTTGCCACTGGTTCTGATGACGCCACCTGCCGACTCTTT
GACCTCCGTGCAGACCAGGAGCTCCTGCTGTATTCCCATGACAATATCATCTGTGGCATCACTT
CTGTGGCCTTCTCAAAGAGCGGGCGCCTCCTGCTAGCCGGCTATGACGACTTCAACTGCAGTGT
GTGGGACGCTCTGAAAGGAGGTCGGGCAGGTGTCCTTGCTGGTCATGACAACCGTGTTAGCTGC
TTAGGTGTGACTGATGACGGCATGGCTGTGGCCACTGGCTCCTGGGACAGTTTTCTCAGAATCT
GGAATTGAGTGCTGTATTTTCTGTTCTCCAATGATATTTGGAGAAATCCGTGCTACAGCCATAG
CTGTGAGGAAAAAACCCCTCTACCTTCTATTTGCAGATGAAGTTCTTCTATTGAGGTGACTATA
TATATATAAAAAGCCACTTTCAATAAACTGTAGTTTATTGAAACTCTTCTAACAAAAATGGTGG
TCAAAGAAACAATCAAGACTAAGATCCCTTGCTGCGGTTAAGCCCGTGATATTCACTGAGCGGT
TGTGTTGACTTTATCCCTATCCCGACAGACTCTTGCTTGTGCTAATTGTTTTTCTGTAGATTAG
AGTGCACACTTTATAGCAGGACAACCATTTGTGTTTGCATTTTGTTAAGGCCTACCATTGAACT
TTGTATATACAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039101982 ⟹ XP_038957910

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	117,289,112 - 117,329,050 (-)	NCBI
mRatBN7.2	2	115,360,746 - 115,400,621 (-)	NCBI

RefSeq Acc Id:

XM_063281562 ⟹ XP_063137632

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	117,289,112 - 117,329,046 (-)	NCBI

RefSeq Acc Id:

XR_005500258

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	117,289,112 - 117,329,049 (-)	NCBI
mRatBN7.2	2	115,360,746 - 115,400,678 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013932	(Get FASTA)	NCBI Sequence Viewer
	XP_038957910	(Get FASTA)	NCBI Sequence Viewer
	XP_063137632	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB82552	(Get FASTA)	NCBI Sequence Viewer
	AAH97370	(Get FASTA)	NCBI Sequence Viewer
	AAS59142	(Get FASTA)	NCBI Sequence Viewer
	AAZ23828	(Get FASTA)	NCBI Sequence Viewer
	AAZ23829	(Get FASTA)	NCBI Sequence Viewer
	EDM01195	(Get FASTA)	NCBI Sequence Viewer
	EDM01196	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074669
	ENSRNOP00000074669.2
GenBank Protein	O35353	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013932 ⟸ NM_001013910

- UniProtKB:

Q4V8I8 (UniProtKB/Swiss-Prot), Q6Q8B2 (UniProtKB/Swiss-Prot), O35353 (UniProtKB/Swiss-Prot), A0A0G2K8M9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWG
YDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKT
REGNVRVSRELPGHTGYLSCCRFLDDGQIITSSGDTTCALWDIETGQQTTTFTGHSGDVMSLSL
SPDLKTFVSGACDASSKLWDIRDGMCRQSFTGHISDINAVSFFPSGYAFATGSDDATCRLFDLR
ADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCSVWDALKGGRAGVLAGHDNRVSCLGV
TDDGMAVATGSWDSFLRIWN

hide sequence

Ensembl Acc Id:

ENSRNOP00000074669 ⟸ ENSRNOT00000087803

Ensembl Acc Id:

ENSRNOP00000014871 ⟸ ENSRNOT00000014871

RefSeq Acc Id:	XP_038957910 ⟸ XM_039101982
- Peptide Label:	isoform X1
- UniProtKB:	Q4V8I8 (UniProtKB/Swiss-Prot), O35353 (UniProtKB/Swiss-Prot), Q6Q8B2 (UniProtKB/Swiss-Prot), A0A0G2K8M9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000077504 ⟸ ENSRNOT00000113393

RefSeq Acc Id:	XP_063137632 ⟸ XM_063281562
- Peptide Label:	isoform X1
- UniProtKB:	Q6Q8B2 (UniProtKB/Swiss-Prot), Q4V8I8 (UniProtKB/Swiss-Prot), O35353 (UniProtKB/Swiss-Prot), A0A0G2K8M9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000106318 ⟸ ENSRNOT00000172178

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35353-F1-model_v2	AlphaFold	O35353	1-340	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359321	AgrOrtholog
BioCyc Gene	G2FUF-53428	BioCyc
Ensembl Genes	ENSRNOG00000011070	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000087803	ENTREZGENE
	ENSRNOT00000087803.2	UniProtKB/Swiss-Prot
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7444022	IMAGE-MGC_LOAD
InterPro	G-protein_beta_WD-40_rep	UniProtKB/Swiss-Prot
	Gprotein_B	UniProtKB/Swiss-Prot
	Guanine_nucleotide-bd_bsu	UniProtKB/Swiss-Prot
	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot
	WD40_repeat	UniProtKB/Swiss-Prot
	WD40_repeat_CS	UniProtKB/Swiss-Prot
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:294962	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114405	IMAGE-MGC_LOAD
NCBI Gene	294962	ENTREZGENE
PANTHER	PTHR19850	UniProtKB/Swiss-Prot
Pfam	WD40_Gbeta	UniProtKB/Swiss-Prot
PhenoGen	Gnb4	PhenoGen
PIRSF	GN-bd_beta	UniProtKB/Swiss-Prot
PRINTS	GPROTEINB	UniProtKB/Swiss-Prot
	GPROTEINBRPT	UniProtKB/Swiss-Prot
PROSITE	WD_REPEATS_1	UniProtKB/Swiss-Prot
	WD_REPEATS_2	UniProtKB/Swiss-Prot
	WD_REPEATS_REGION	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011070	RatGTEx
SMART	WD40	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot
UniProt	A0A0G2K8M9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y5X0_RAT	UniProtKB/TrEMBL
	A0ABK0LP37_RAT	UniProtKB/TrEMBL
	A6IHP7_RAT	UniProtKB/TrEMBL
	A6IHP8_RAT	UniProtKB/TrEMBL
	D4A752_RAT	UniProtKB/TrEMBL
	GBB4_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q45QL2_RAT	UniProtKB/TrEMBL
	Q4V8I8	ENTREZGENE
	Q6Q8B2	ENTREZGENE
UniProt Secondary	Q4V8I8	UniProtKB/Swiss-Prot
	Q6Q8B2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Gnb4	G protein subunit beta 4	LOC103691541	guanine nucleotide-binding protein subunit beta-4-like	Data merged from RGD:9298383	737654	PROVISIONAL
2016-03-15	Gnb4	G protein subunit beta 4	Gnb4	guanine nucleotide binding protein (G protein), beta polypeptide 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-08-25	LOC103691541	guanine nucleotide-binding protein subunit beta-4-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-09-26	Gnb4	guanine nucleotide binding protein (G protein), beta polypeptide 4	Gnb4	guanine nucleotide binding protein (G protein), beta 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-15	Gnb4	guanine nucleotide binding protein (G protein), beta 4	Gnb4	guanine nucleotide binding protein, beta 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Gnb4	guanine nucleotide binding protein, beta 4	Gnb4	guanine nucleotide binding protein beta 4 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-29	Gnb4	guanine nucleotide binding protein beta 4 subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)