Advanced Search (OLGA)

Gene: Plet1 (placenta expressed transcript 1) Rattus norvegicus

Analyze

Symbol:

Plet1

Name:

placenta expressed transcript 1

RGD ID:

1359217

Description:

Predicted to be involved in negative regulation of cell-matrix adhesion; positive regulation of cell migration; and wound healing, spreading of epidermal cells. Predicted to be located in plasma membrane and side of membrane. Predicted to be active in apical plasma membrane and external side of plasma membrane. Orthologous to human PLET1 (placenta expressed transcript 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC363060; placenta-expressed transcript 1 protein; similar to RIKEN cDNA 1600029D21

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	59,738,639 - 59,750,062 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	59,738,529 - 59,750,406 (+)	Ensembl				GRCr8
mRatBN7.2	8	50,842,242 - 50,853,666 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	50,841,854 - 50,853,659 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	56,347,681 - 56,359,094 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	54,626,579 - 54,637,993 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	52,490,849 - 52,502,263 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	54,925,624 - 54,937,068 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	54,925,607 - 54,937,177 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	53,522,634 - 53,534,391 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	53,852,103 - 53,863,444 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	50,391,283 - 50,402,408 (+)	NCBI		Celera
RGSC_v3.1	8	53,871,156 - 53,882,498 (+)	NCBI
Cytogenetic Map	8	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

dibenzo[a,l]pyrene (ISO)

diethyl phthalate (EXP)

dimethylarsinic acid (ISO)

endosulfan (EXP)

folic acid (ISO)

fulvestrant (ISO)

inulin (ISO)

methylarsonic acid (ISO)

nitrofen (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

testosterone (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

negative regulation of cell-matrix adhesion (IBA,ISO,ISS)

positive regulation of cell migration (IBA,ISO,ISS)

wound healing, spreading of epidermal cells (IBA,ISO,ISS)

Cellular Component

apical plasma membrane (IBA,IEA,ISO,ISS)

external side of plasma membrane (IBA,ISO)

side of membrane (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	PLET1 (C11orf34), a highly expressed and processed novel gene in pig and mouse placenta, is transcribed but poorly spliced in human.	Zhao SH, etal., Genomics 2004 Jul;84(1):114-25.

Additional References at PubMed

PMID:12477932	PMID:20130590	PMID:22072979

Genomics

Comparative Map Data

Plet1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	59,738,639 - 59,750,062 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	59,738,529 - 59,750,406 (+)	Ensembl				GRCr8
mRatBN7.2	8	50,842,242 - 50,853,666 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	50,841,854 - 50,853,659 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	56,347,681 - 56,359,094 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	54,626,579 - 54,637,993 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	52,490,849 - 52,502,263 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	54,925,624 - 54,937,068 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	54,925,607 - 54,937,177 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	53,522,634 - 53,534,391 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	53,852,103 - 53,863,444 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	50,391,283 - 50,402,408 (+)	NCBI		Celera
RGSC_v3.1	8	53,871,156 - 53,882,498 (+)	NCBI
Cytogenetic Map	8	q23	NCBI

PLET1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	112,248,153 - 112,260,860 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	112,248,153 - 112,260,860 (-)	Ensembl			hg38	GRCh38
GRCh37	11	112,118,876 - 112,131,583 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	111,624,732 - 111,636,793 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	11	109,272,110 - 109,284,574 (-)	NCBI		Celera
Cytogenetic Map	11	q23.1	NCBI
HuRef	11	108,044,417 - 108,059,257 (-)	NCBI		HuRef
CHM1_1	11	112,002,334 - 112,014,980 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	112,258,488 - 112,271,159 (-)	NCBI		T2T-CHM13v2.0

Plet1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	50,405,825 - 50,416,939 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	50,405,825 - 50,416,782 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	50,494,525 - 50,505,639 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	50,494,525 - 50,505,482 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	50,302,630 - 50,313,744 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	50,246,755 - 50,257,363 (+)	NCBI		MGSCv36	mm8
Celera	9	47,784,391 - 47,795,440 (+)	NCBI		Celera
Cytogenetic Map	9	A5.3	NCBI
cM Map	9	27.71	NCBI

Plet1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	13,901,950 - 13,912,999 (-)	Ensembl
ChiLan1.0	NW_004955412	13,902,940 - 13,912,761 (-)	NCBI	ChiLan1.0	ChiLan1.0

PLET1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	112,993,663 - 113,015,932 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	114,082,475 - 114,110,364 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	107,126,523 - 107,141,857 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	110,971,824 - 110,984,838 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	110,971,824 - 110,984,838 (-)	Ensembl			panPan2	panpan1.1

PLET1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	20,883,678 - 20,894,914 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	20,807,580 - 20,819,776 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	20,907,009 - 20,919,208 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	20,906,970 - 20,917,050 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	20,969,961 - 20,982,157 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	20,870,240 - 20,883,318 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	20,918,126 - 20,930,544 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

PLET1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	39,936,372 - 39,949,683 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	39,936,355 - 39,949,709 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	44,868,858 - 44,903,234 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	9	p24-p13	NCBI

PLET1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	103,597,552 - 103,610,483 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666043	22,375,999 - 22,388,933 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plet1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624784	7,378,939 - 7,389,334 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Plet1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	97,602,100 - 97,604,689 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Plet1
40 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	357
Count of miRNA genes:	195
Interacting mature miRNAs:	222
Transcripts:	ENSRNOT00000059210
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	16994642	61994642	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	15952279	60952279	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	16994642	61994642	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	58991697	91341052	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	58991697	91341052	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	37760859	61459705	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	49610204	68373388	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	17993862	62252873	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	50763951	67219641	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	58991697	91341052	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat

Markers in Region

AU043048

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	50,853,259 - 50,853,390 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	54,936,662 - 54,936,792	NCBI	Rnor6.0
Rnor_5.0	8	53,533,985 - 53,534,115	UniSTS	Rnor5.0
RGSC_v3.4	8	53,863,099 - 53,863,229	UniSTS	RGSC3.4
Celera	8	50,402,063 - 50,402,193	UniSTS
Cytogenetic Map	8	q23	UniSTS

RH130443

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	50,853,367 - 50,853,569 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	54,936,770 - 54,936,971	NCBI	Rnor6.0
Rnor_5.0	8	53,534,093 - 53,534,294	UniSTS	Rnor5.0
RGSC_v3.4	8	53,863,207 - 53,863,408	UniSTS	RGSC3.4
Celera	8	50,402,171 - 50,402,372	UniSTS
Cytogenetic Map	8	q23	UniSTS

AA800756

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	59,749,290 - 59,750,275 (+)	Marker Load Pipeline
mRatBN7.2	8	50,852,894 - 50,853,879 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	54,936,297 - 54,937,281	NCBI	Rnor6.0
Rnor_5.0	8	53,533,620 - 53,534,604	UniSTS	Rnor5.0
RGSC_v3.4	8	53,862,734 - 53,863,718	UniSTS	RGSC3.4
Celera	8	50,401,698 - 50,402,682	UniSTS
RH 3.4 Map	8	544.4	UniSTS
Cytogenetic Map	8	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	49	147	85	84	53	43	53	6	282	124	9	123	81	86	31	13	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001393867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000059210 ⟹ ENSRNOP00000055980

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	59,738,529 - 59,750,406 (+)	Ensembl
mRatBN7.2 Ensembl	8	50,841,854 - 50,853,659 (+)	Ensembl
Rnor_6.0 Ensembl	8	54,925,607 - 54,937,177 (+)	Ensembl

RefSeq Acc Id:

NM_001014209 ⟹ NP_001014231

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	59,738,639 - 59,750,062 (+)	NCBI
mRatBN7.2	8	50,842,242 - 50,853,666 (+)	NCBI
Rnor_6.0	8	54,925,666 - 54,937,007 (+)	NCBI
Rnor_5.0	8	53,522,634 - 53,534,391 (+)	NCBI
RGSC_v3.4	8	53,852,103 - 53,863,444 (+)	RGD
Celera	8	50,391,283 - 50,402,408 (+)	RGD

Sequence:

show sequence

CCCAAACAGACCGGAACCATGCCTGCACTCCGCACCTTGCTGCCACACCTGGGGCTGTTCCTGT
GCCTGGCTCTGTGCTTTTCCCCTTCCTTCTCTCTCAGCAATAATGAGTCCTGCATACTTTACGA
TCAAGTCTACCCCTCTGACAACTTGATCAACGCTTCAGCTGAGGAGGTCTCTGGTGAGAATACA
ACCTACACAGTGACAGTCCCTGTGAACGATTCAGTCAGTGCTGTGATCCTGAAAGCTGAAAAAG
ACAACAAACCAGTGGGCACCTGGAGCGGAGCATACGAGAAGTGCAACAACAGCGTTGTCTACAA
CTTGACATCTCTAAACAACTCAGCCTTCCAGACAAACTGGACCGTTCCTAGTTCTGAGGACGTG
ACTAAAGTCAACCTGACGATCTTCATTGTCATCAACCGCACAGCTACAGTGTCATCTGTGAAAC
TGGAGCCAAAAGAAACTTCAAGCTTGGCCTCTACTCCTGAGAGCCAGACCTCAGCCATGACTAC
AGCCATGACCTCAGCCATGACTACAGCCAAGACTACAGCCGTGGCCACAAACAGTAGCACAGAC
GTGACCTCAGACAATAGCACCGCCGTGACCACAGCCAATAGCACCGCCGTGACCACAGCCAATA
GCACAGCCGTGACCACAGCCAAGACCACAACCATGACCACAGCCACGACCACAGCCAAAAGCCT
GGCCATCCGTACTCTCTGCAGCCCCCTGGCAGGCGCCCTCCATATCCTGCTTGTTTTTCTCATT
AGTAAACTCCTCTTCTGAAGGAAACTGGGGGAAACAAATCTCCAACCTCCAGGGCATCCTCCCG
AGCTCAAACATACATGAATGAAGGTTTCATGTCCTCAGTCTGCAACTCCACCACCTCGGACCAC
AGACCTGAGACACTAGTGCGTTTGAGGGACACAAACATTTGCCTGGATCTTTCAGGCCACAAAT
TCTGCTTTTTGTAAATACTTAGTCCATCCTGCTTGTAACCTGAAGTTCTGACTCTCAGGTTAAC
ATGTTAACAGCCAATCTGAACTTGCGTTTCTTGCCAAAGTATTCCCATGAGCCTCCTGGGTTTG
GGGGTGGGGAGGGGAATATCCTTCATTCAAGCTGATTTCAGATTTCTGGCCAAACCTACTCAGG
TTACAAAGGACTTATGTGACTGAAGGAAAAAGAGAAATGAGTGATAGTCCTGTGGCTACTAGCA
CATTCCCACCATGCCCAGACCAGTCAGTAGGTTTCAAAGAGAGAAAATATATGAAAACTATGCC
TCAGAAAAAAAAAAAAAAAAAAAAAAAAAAGG

hide sequence

RefSeq Acc Id:

NM_001393867 ⟹ NP_001380796

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	59,738,639 - 59,750,062 (+)	NCBI
mRatBN7.2	8	50,842,242 - 50,853,666 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014231	(Get FASTA)	NCBI Sequence Viewer
	NP_001380796	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88858	(Get FASTA)	NCBI Sequence Viewer
	EDL95455	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000055980
GenBank Protein	Q5HZW7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001014231 ⟸ NM_001014209
- Peptide Label:	isoform 1 precursor
- UniProtKB:	Q5HZW7 (UniProtKB/Swiss-Prot), A0A8L2QTA5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPALRTLLPHLGLFLCLALCFSPSFSLSNNESCILYDQVYPSDNLINASAEEVSGENTTYTVTV PVNDSVSAVILKAEKDNKPVGTWSGAYEKCNNSVVYNLTSLNNSAFQTNWTVPSSEDVTKVNLT IFIVINRTATVSSVKLEPKETSSLASTPESQTSAMTTAMTSAMTTAKTTAVATNSSTDVTSDNS TAVTTANSTAVTTANSTAVTTAKTTTMTTATTTAKSLAIRTLCSPLAGALHILLVFLISKLLF hide sequence

Ensembl Acc Id:

ENSRNOP00000055980 ⟸ ENSRNOT00000059210

RefSeq Acc Id:	NP_001380796 ⟸ NM_001393867
- Peptide Label:	isoform 2 precursor
- UniProtKB:	A6J4D2 (UniProtKB/TrEMBL), A0A8L2QTA5 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5HZW7-F1-model_v2	AlphaFold	Q5HZW7	1-255	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695942

Promoter ID:

EPDNEW_R6467

Type:

single initiation site

Name:

Plet1_1

Description:

placenta expressed transcript 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	54,925,646 - 54,925,706	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359217	AgrOrtholog
BioCyc Gene	G2FUF-30565	BioCyc
Ensembl Genes	ENSRNOG00000024346	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000059210	ENTREZGENE
IMAGE_CLONE	IMAGE:7308076	IMAGE-MGC_LOAD
InterPro	PLET1	UniProtKB/Swiss-Prot
KEGG Report	rno:363060	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105694	IMAGE-MGC_LOAD
NCBI Gene	363060	ENTREZGENE
PANTHER	PLACENTA-EXPRESSED TRANSCRIPT 1 PROTEIN	UniProtKB/Swiss-Prot
	PTHR22527	UniProtKB/Swiss-Prot
PhenoGen	Plet1	PhenoGen
RatGTEx	ENSRNOG00000024346	RatGTEx
UniProt	A0A8L2QTA5	ENTREZGENE, UniProtKB/TrEMBL
	A6J4D2	ENTREZGENE, UniProtKB/TrEMBL
	PLET1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-11-20	Plet1	placenta expressed transcript 1	LOC363060	similar to RIKEN cDNA 1600029D21	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-29	LOC363060	similar to RIKEN cDNA 1600029D21			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message