Advanced Search (OLGA)

Gene: Paip2 (poly(A) binding protein interacting protein 2) Rattus norvegicus

Analyze

Symbol:

Paip2

Name:

poly(A) binding protein interacting protein 2

RGD ID:

1359176

Description:

Predicted to enable mRNA binding activity and translation repressor activity. Predicted to be involved in negative regulation of translational initiation. Predicted to act upstream of or within several processes, including memory; regulation of long-term synaptic potentiation; and spermatogenesis. Predicted to be active in cytoplasm. Orthologous to human PAIP2 (poly(A) binding protein interacting protein 2); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC361309; PABP-interacting protein 2; PAIP-2; poly(A)-binding protein-interacting protein 2; polyadenylate-binding protein interacting protein 2; polyadenylate-binding protein-interacting protein 2; similar to polyadenylate-binding protein-interacting protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Paip2l1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,475,278 - 27,492,452 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	188,508,623 - 188,508,997 (+)	Ensembl				GRCr8
GRCr8 Ensembl	18	27,473,882 - 27,492,451 (+)	Ensembl				GRCr8
mRatBN7.2	18	27,199,762 - 27,218,359 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,199,796 - 27,214,863 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	1	179,077,601 - 179,077,975 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	27,328,608 - 27,345,782 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,090,702 - 28,107,928 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,425,587 - 27,442,814 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,397,320 - 28,415,911 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,409,955 - 28,415,910 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	28,111,847 - 28,129,021 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	28,223,680 - 28,240,856 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	26,934,764 - 26,951,907 (+)	NCBI		Celera
RGSC_v3.1	18	28,250,325 - 28,267,501 (+)	NCBI
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Colorectal Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

6-propyl-2-thiouracil (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

CU-O LINKAGE (ISO)

D-glucose (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fructose (ISO)

glucose (ISO)

indometacin (ISO)

methidathion (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

ozone (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

memory (ISO)

negative regulation of translation (IBA,ISO)

negative regulation of translational initiation (IEA,ISO)

regulation of long-term synaptic potentiation (ISO)

regulation of translation (IEA,ISO)

spermatogenesis (ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO)

Molecular Function

mRNA binding (ISO)

mRNA regulatory element binding translation repressor activity (IEA)

protein binding (ISO)

translation repressor activity (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11172725	PMID:15489334	PMID:20739757	PMID:22190698	PMID:23622065

Genomics

Comparative Map Data

Paip2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	27,475,278 - 27,492,452 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	188,508,623 - 188,508,997 (+)	Ensembl				GRCr8
GRCr8 Ensembl	18	27,473,882 - 27,492,451 (+)	Ensembl				GRCr8
mRatBN7.2	18	27,199,762 - 27,218,359 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	27,199,796 - 27,214,863 (+)	Ensembl				mRatBN7.2
mRatBN7.2 Ensembl	1	179,077,601 - 179,077,975 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	18	27,328,608 - 27,345,782 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,090,702 - 28,107,928 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	27,425,587 - 27,442,814 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	28,397,320 - 28,415,911 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	28,409,955 - 28,415,910 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	18	28,111,847 - 28,129,021 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	18	28,223,680 - 28,240,856 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	18	26,934,764 - 26,951,907 (+)	NCBI		Celera
RGSC_v3.1	18	28,250,325 - 28,267,501 (+)	NCBI
Cytogenetic Map	18	p11	NCBI

PAIP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	139,341,854 - 139,369,717 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	139,341,587 - 139,369,720 (+)	Ensembl			hg38	GRCh38
GRCh37	5	138,677,543 - 138,705,406 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	138,705,418 - 138,733,308 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	5	138,705,449 - 138,733,305	NCBI
Celera	5	134,799,217 - 134,827,120 (+)	NCBI		Celera
Cytogenetic Map	5	q31.2	NCBI
HuRef	5	133,867,084 - 133,895,145 (+)	NCBI		HuRef
CHM1_1	5	138,110,119 - 138,138,025 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	139,867,910 - 139,895,795 (+)	NCBI		T2T-CHM13v2.0

Paip2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	35,731,649 - 35,750,239 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	35,731,670 - 35,750,240 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	35,598,610 - 35,617,186 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	35,598,617 - 35,617,187 (+)	Ensembl			mm10	GRCm38
MGSCv37	18	35,758,321 - 35,776,839 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	35,724,641 - 35,743,159 (+)	NCBI		MGSCv36	mm8
Celera	18	36,054,656 - 36,073,337 (+)	NCBI		Celera
Cytogenetic Map	18	B2	NCBI
cM Map	18	19.16	NCBI

Paip2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	1,189,822 - 1,208,559 (-)	Ensembl
ChiLan1.0	NW_004955418	1,189,822 - 1,208,559 (-)	NCBI	ChiLan1.0	ChiLan1.0

PAIP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	134,608,493 - 134,636,576 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	132,748,046 - 132,776,128 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	134,712,834 - 134,740,747 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	140,835,320 - 140,862,743 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	140,835,320 - 140,862,743 (+)	Ensembl			panPan2	panpan1.1

PAIP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	34,671,130 - 34,695,974 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	34,671,150 - 34,695,299 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	31,773,440 - 31,798,270 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	35,125,205 - 35,150,041 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	35,125,241 - 35,150,039 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	32,177,630 - 32,202,503 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	33,043,986 - 33,068,801 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	33,795,586 - 33,820,421 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Paip2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	153,157,525 - 153,179,576 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936531	8,431,798 - 8,456,498 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936531	8,431,950 - 8,453,980 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PAIP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	141,237,438 - 141,261,125 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	141,237,417 - 141,260,207 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	147,068,026 - 147,090,813 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PAIP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	42,002,525 - 42,042,056 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	42,002,482 - 42,042,777 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666034	35,845,934 - 35,887,870 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Paip2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624743	32,152,007 - 32,171,111 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Paip2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	15	8,752,155 - 8,770,518 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Paip2
95 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	418
Count of miRNA genes:	233
Interacting mature miRNAs:	280
Transcripts:	ENSRNOT00000026989
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25071126	83910656	Rat
2301409	Cm70	Cardiac mass QTL 70		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	18	7065728	52065728	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	22015562	61600538	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	15642280	31610627	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	12216684	31644508	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26822186	71822186	Rat
12904716	Am21	Aortic mass QTL 21		0.005	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	7065728	52065728	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	23494057	85487725	Rat
12904714	Cm131	Cardiac mass QTL 131		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	7065728	52065728	Rat
12904715	Cm132	Cardiac mass QTL 132		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	7065728	52065728	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26822186	71822186	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	15226101	42690662	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26822186	71822186	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	31610627	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26822186	71822186	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5460455	42690191	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	26415821	71415821	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	3917226	48917226	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26822186	71822186	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	31610627	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26822186	71822186	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26822186	71822186	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	12216684	31644508	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	31610627	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	1	44930869	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19553532	85493247	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	12066482	57066482	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	12066482	85493247	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	3811902	30809809	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34566578	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4482648	49482648	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	54490981	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	12066482	85493247	Rat
11565454	Kidm59	Kidney mass QTL 59		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	7065728	52065728	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	15642280	86134022	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34566578	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	4307354	49307354	Rat

Markers in Region

RH129257

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,218,120 - 27,218,272 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	179,078,689 - 179,078,953 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	193,699,300 - 193,699,584	NCBI	Rnor6.0
Rnor_6.0	18	28,415,673 - 28,415,824	NCBI	Rnor6.0
Rnor_5.0	18	28,128,783 - 28,128,934	UniSTS	Rnor5.0
Rnor_5.0	1	200,756,118 - 200,756,402	UniSTS	Rnor5.0
RGSC_v3.4	1	183,456,241 - 183,457,302	UniSTS	RGSC3.4
RGSC_v3.4	18	28,240,618 - 28,240,769	UniSTS	RGSC3.4
Celera	18	26,951,669 - 26,951,820	UniSTS
Celera	1	176,757,650 - 176,757,801	UniSTS
Cytogenetic Map	18	p11	UniSTS

RH133364

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	179,077,849 - 179,078,028 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	193,700,246 - 193,700,424	NCBI	Rnor6.0
Rnor_5.0	1	200,757,064 - 200,757,242	UniSTS	Rnor5.0
RGSC_v3.4	1	183,455,401 - 183,455,579	UniSTS	RGSC3.4
Celera	1	176,756,810 - 176,756,988	UniSTS
Cytogenetic Map	18	p11	UniSTS
Cytogenetic Map	1	q36	UniSTS

RH137333

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,216,660 - 27,216,844 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	28,414,213 - 28,414,396	NCBI	Rnor6.0
Rnor_5.0	18	28,127,323 - 28,127,506	UniSTS	Rnor5.0
RGSC_v3.4	18	28,239,158 - 28,239,341	UniSTS	RGSC3.4
Celera	18	26,950,209 - 26,950,392	UniSTS
Cytogenetic Map	18	p11	UniSTS

AI409047

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	27,214,561 - 27,214,658 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	28,412,114 - 28,412,210	NCBI	Rnor6.0
Rnor_5.0	18	28,125,224 - 28,125,320	UniSTS	Rnor5.0
RGSC_v3.4	18	28,237,059 - 28,237,155	UniSTS	RGSC3.4
Celera	18	26,948,110 - 26,948,206	UniSTS
RH 3.4 Map	18	375.7	UniSTS
Cytogenetic Map	18	p11	UniSTS

D5S2301E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	179,077,600 - 179,077,712 (-)	MAPPER	mRatBN7.2
mRatBN7.2	18	27,212,433 - 27,212,545 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	28,409,986 - 28,410,097	NCBI	Rnor6.0
Rnor_6.0	1	193,700,562 - 193,700,673	NCBI	Rnor6.0
Rnor_5.0	18	28,123,096 - 28,123,207	UniSTS	Rnor5.0
Rnor_5.0	1	200,757,380 - 200,757,491	UniSTS	Rnor5.0
RGSC_v3.4	1	183,455,152 - 183,455,263	UniSTS	RGSC3.4
RGSC_v3.4	18	28,234,931 - 28,235,042	UniSTS	RGSC3.4
Celera	18	26,945,982 - 26,946,093	UniSTS
Celera	1	176,756,561 - 176,756,672	UniSTS
Cytogenetic Map	18	p11	UniSTS
Cytogenetic Map	1	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026989 ⟹ ENSRNOP00000026989

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	27,473,882 - 27,492,451 (+)	Ensembl
mRatBN7.2 Ensembl	18	27,199,796 - 27,214,863 (+)	Ensembl
Rnor_6.0 Ensembl	18	28,409,955 - 28,415,910 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000071314 ⟹ ENSRNOP00000066154

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	188,508,623 - 188,508,997 (+)	Ensembl
mRatBN7.2 Ensembl	1	179,077,601 - 179,077,975 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000156970 ⟹ ENSRNOP00000099168

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	18	27,473,886 - 27,492,451 (+)	Ensembl

RefSeq Acc Id:

NM_001014148 ⟹ NP_001014170

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	27,475,278 - 27,492,452 (+)	NCBI
mRatBN7.2	18	27,201,185 - 27,218,359 (+)	NCBI
Rnor_6.0	18	28,398,737 - 28,415,911 (+)	NCBI
Rnor_5.0	18	28,111,847 - 28,129,021 (+)	NCBI
RGSC_v3.4	18	28,223,680 - 28,240,856 (+)	RGD
Celera	18	26,934,764 - 26,951,907 (+)	RGD

Sequence:

show sequence

GGCGATTCACTGTAATGGTTAAAGGCTGTGCATATTGGTCCTTGAGAACTCAAACCGAGGGGTT
AAAATATATTTTGATGAAATGTCCATCTGTCACCACCCAGCCACCCACCCCTGCCAAAACAGGG
TTACTTAGCCCTGGCTGTCCTGGAACTCACTGTAGACCAGGGTGACCTCAATCTACCAGCCTCT
GCCTTCCAAGTGCTGGAATTAAAGTAGCCTGGAGCTGCTATATAGACCAAACTGGCCTCCAAGT
CACAGAAATCCACCTGCCTCTACCTCCTGAGAGCTAGAAGTAAAGGTTAAAAACGACAACGAAC
ACCAACCATGAAAGATCCAAGTCGCAGCAGTACTAGCCCAAGCATCATCAATGACGATGTGATT
ATTAACGGTCATTCTCATGAAGAGGATAATCCATTTGCAGAGTACATGTGGATGGAAAATGAAG
AGGAATTCAACAGACAAATAGAAGAGGAGTTGTGGGAAGAAGAATTTATTGAACGCTGTTTCCA
AGAAATGCTGGAAGAGGAAGAAGAACATGAATGGTTTATTCCAGCCCGAGATCTCCCACAAACT
ATGGACCAAATCCAAGACCAGTTTAATGACCTTGTTATCAGTGATGGCTCTTCTCTGGAAGATC
TTGTGGTGAAGAGCAATCTGAATCCCAATGCAAAGGAGTTTGTTCCTGGGGTGAAGTACTGACA
TGTCTGAGCAGCCGGCCGCTTTGGGTGGATGTAGCACAGTTTCCACACTGGGAAGGCAGTGTTA
GAAGACTCCATTGTAAAAGCTCTCTCTCGTCACTGTGTTACACTTACGCATTGCCAAAGTTTTT
GTTAGTCTTGCATGCTTAATAAAAGTGCTGAGACTGTTACTAAGTAAGAAGCTGTCACACAGTT
ACTGAAAGTAGAATTGGCCGCATGGCTTGATGTAAAGACAGCAGGAAGAAGCACCAGTCGATTG
TGACAAAGAACCAAATTAAATCACCTCCAAATCTCACTGAATTGTCTGTCTTTGAGGCTAAACT
GGTCCCTTAGGATTAGTTGACACTTTTTAATGTCTACACGTTGTAAAAAAAATAAGTAAATAAG
TAAGTTTAAATTAAGTTCTGATTGTTAAACAGATTTCTCAGTTGCATTTGTCCATCAAAAATAA
CCTTTTCTGGAGAAAATCTGTTAACTTTTAAAGTAATTTCACAAGAATGTCTTTGCCTGAGGTT
ACAAGGTGGTGGTCAGATGGGATCTAGTCTGTCTGACTTTTGCCTGGTGTATTATCATGTTAGG
AATGCTGCGTTCTCCTAGTGTTAAGCTTGAGGAAATACAATTGGAGGCTTGCGTCTTCTGAAGA
TTGATTGCATCATACCATCCGTGTGAAGTCTAACCAGGACCCACACCAACCCATAACCCAATTG
AAGCACTCAAGAGACAGTGGCGTGACTTTGGTGCTCTTCCCTGCTTTGTTAATAACCATCATGA
CTATAGTCTGCAGCACACGTTTTCTTTTAACAAAGCTAGAACAGTTTTGGCTTCTTAAACTTCA
TATTTGAGTAGGTTAAGCTGCCATACGTGTTCAGTGTGAATAGTGTTTAAGTTGAAAATATTGT
AAAAAAATTATATTTTTTCAAAAATATTTAAAAAAATAAATGATAGTAGAACTGAAAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001014170	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79261	(Get FASTA)	NCBI Sequence Viewer
	EDL76263	(Get FASTA)	NCBI Sequence Viewer
	EDL76264	(Get FASTA)	NCBI Sequence Viewer
	EDL76267	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026989
GenBank Protein	Q6AXZ0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001014170 ⟸ NM_001014148
- UniProtKB:	Q6AXZ0 (UniProtKB/Swiss-Prot), A6J2Y1 (UniProtKB/TrEMBL), M0R9I5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKDPSRSSTSPSIINDDVIINGHSHEEDNPFAEYMWMENEEEFNRQIEEELWEEEFIERCFQEM LEEEEEHEWFIPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNAKEFVPGVKY hide sequence

Ensembl Acc Id:

ENSRNOP00000026989 ⟸ ENSRNOT00000026989

Ensembl Acc Id:

ENSRNOP00000066154 ⟸ ENSRNOT00000071314

Ensembl Acc Id:

ENSRNOP00000099168 ⟸ ENSRNOT00000156970

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXZ0-F1-model_v2	AlphaFold	Q6AXZ0	1-124	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359176	AgrOrtholog
BioCyc Gene	G2FUF-7902	BioCyc
Ensembl Genes	ENSRNOG00000019934	Ensembl, ENTREZGENE
	ENSRNOG00000048424	Ensembl
Ensembl Transcript	ENSRNOT00000026989	ENTREZGENE
IMAGE_CLONE	IMAGE:7133501	IMAGE-MGC_LOAD
InterPro	Ataxin-2_C	UniProtKB/Swiss-Prot
	PAIP2-like	UniProtKB/Swiss-Prot
KEGG Report	rno:361309	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94367	IMAGE-MGC_LOAD
NCBI Gene	361309	ENTREZGENE
PANTHER	POLYADENYLATE-BINDING PROTEIN-INTERACTING PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR13154	UniProtKB/Swiss-Prot
Pfam	PAM2	UniProtKB/Swiss-Prot
PhenoGen	Paip2	PhenoGen
RatGTEx	ENSRNOG00000019934	RatGTEx
	ENSRNOG00000048424	RatGTEx
UniProt	A0A8L2QEB8_RAT	UniProtKB/TrEMBL
	A0ABK0KX42_RAT	UniProtKB/TrEMBL
	A6J2Y1	ENTREZGENE, UniProtKB/TrEMBL
	M0R9I5	ENTREZGENE
	PAIP2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-17	Paip2	poly(A) binding protein interacting protein 2	Paip2	polyadenylate-binding protein interacting protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Paip2	polyadenylate-binding protein interacting protein 2	LOC361309	similar to polyadenylate-binding protein-interacting protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-29	LOC361309	similar to polyadenylate-binding protein-interacting protein 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD