Sft2d1 (SFT2 domain containing 1)

Advanced Search (OLGA)

Gene: Sft2d1 (SFT2 domain containing 1) Rattus norvegicus

Analyze

Symbol:

Sft2d1

Name:

SFT2 domain containing 1

RGD ID:

1359119

Description:

Predicted to be involved in protein transport and vesicle-mediated transport. Predicted to be located in several cellular components, including cytoplasm; endomembrane system; and intracellular membrane-bounded organelle. Orthologous to human SFT2D1 (SFT2 domain containing 1); INTERACTS WITH 17alpha-ethynylestradiol; 2,2',5,5'-tetrachlorobiphenyl; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC105508; SFT2 domain-containing protein 1; similar to chromosome 6 open reading frame 83; similar to RIKEN cDNA 5630401J11; vesicle transport protein SFT2A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SFT2D1 (SFT2 domain containing 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sft2d1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sft2d1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SFT2D1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SFT2D1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sft2d1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SFT2D1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SFT2D1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sft2d1 (SFT2 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SFT2D2 (SFT2 domain containing 2)	HGNC	OrthoDB
Homo sapiens (human):	C16orf89 (chromosome 16 open reading frame 89)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SFT2D1 (SFT2 domain containing 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Sft2d1 (SFT2 domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sft2d1rt (SFT2 domain containing 1, retrotransposed)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sft2d1 (SFT2 domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F27D4.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5104	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sft2d1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	54,957,247 - 54,973,143 (-)	NCBI		GRCr8
mRatBN7.2	1	52,409,687 - 52,425,583 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	52,409,690 - 52,425,746 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	53,111,158 - 53,127,052 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	59,102,874 - 59,118,770 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	53,186,758 - 53,202,652 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	52,998,548 - 53,014,444 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	52,998,529 - 53,014,466 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	54,248,197 - 54,264,093 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	47,049,663 - 47,065,559 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	47,052,609 - 47,068,504 (-)	NCBI
Celera	1	48,172,663 - 48,188,559 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

bisphenol A (EXP,ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

folic acid (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

nickel atom (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

propiconazole (EXP,ISO)

rac-lactic acid (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloroethene (ISO)

thioacetamide (EXP)

trichloroethene (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein transport (IEA)

vesicle-mediated transport (IEA)

Cellular Component

cytoplasm (IEA)

endomembrane system (IEA)

intracellular membrane-bounded organelle (IEA)

membrane (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	GOA pipeline	RGD automated data pipeline
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:21873635

Genomics

Comparative Map Data

Sft2d1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	54,957,247 - 54,973,143 (-)	NCBI		GRCr8
mRatBN7.2	1	52,409,687 - 52,425,583 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	52,409,690 - 52,425,746 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	53,111,158 - 53,127,052 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	59,102,874 - 59,118,770 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	53,186,758 - 53,202,652 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	52,998,548 - 53,014,444 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	52,998,529 - 53,014,466 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	54,248,197 - 54,264,093 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	47,049,663 - 47,065,559 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	47,052,609 - 47,068,504 (-)	NCBI
Celera	1	48,172,663 - 48,188,559 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

SFT2D1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	166,319,728 - 166,342,545 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	166,319,728 - 166,342,576 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	166,733,216 - 166,756,033 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	166,653,506 - 166,675,981 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	166,703,928 - 166,726,402	NCBI
Celera	6	167,472,881 - 167,495,356 (-)	NCBI		Celera
Cytogenetic Map	6	q27	NCBI
HuRef	6	164,204,467 - 164,226,942 (-)	NCBI		HuRef
CHM1_1	6	166,997,350 - 167,019,834 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	167,696,648 - 167,719,464 (-)	NCBI		T2T-CHM13v2.0

Sft2d1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	8,529,920 - 8,546,274 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	8,529,934 - 8,546,274 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	8,311,088 - 8,327,442 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	8,311,102 - 8,327,442 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	8,503,968 - 8,520,307 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
Celera	17	8,354,819 - 8,371,139 (+)	NCBI		Celera
Cytogenetic Map	17	A1	NCBI
cM Map	17	4.92	NCBI

Sft2d1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	15,555,080 - 15,575,698 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955439	15,555,080 - 15,575,698 (+)	NCBI	ChiLan1.0	ChiLan1.0

SFT2D1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	186,527,805 - 186,556,882 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	184,423,702 - 184,452,799 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	164,286,432 - 164,310,616 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	169,268,096 - 169,290,872 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	169,268,104 - 169,290,872 (-)	Ensembl	panpan1.1		panPan2

SFT2D1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	54,335,832 - 54,354,199 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	54,336,005 - 54,354,137 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	55,122,998 - 55,141,240 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	54,513,121 - 54,531,335 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	54,512,836 - 54,531,296 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	54,409,245 - 54,427,872 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	54,259,609 - 54,277,817 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	54,883,243 - 54,901,832 (-)	NCBI		UU_Cfam_GSD_1.0

Sft2d1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	148,889,930 - 148,907,677 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	16,141,678 - 16,159,647 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936489	16,141,665 - 16,159,648 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SFT2D1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	2,576,729 - 2,593,506 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	2,576,815 - 2,593,516 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	3,716,454 - 3,733,151 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SFT2D1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	94,031,622 - 94,054,924 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	94,031,331 - 94,054,173 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	65,859,340 - 65,882,443 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sft2d1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624785	12,924,593 - 12,945,986 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624785	12,924,569 - 12,945,924 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sft2d1
42 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	316
Count of miRNA genes:	185
Interacting mature miRNAs:	207
Transcripts:	ENSRNOT00000049831
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Markers in Region

RH132411

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	52,409,801 - 52,409,982 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	52,998,663 - 52,998,843	NCBI	Rnor6.0
Rnor_5.0	1	54,248,312 - 54,248,492	UniSTS	Rnor5.0
RGSC_v3.4	1	47,049,778 - 47,049,958	UniSTS	RGSC3.4
Celera	1	48,172,778 - 48,172,958	UniSTS
RH 3.4 Map	1	622.4	UniSTS
Cytogenetic Map	1	q11	UniSTS

BM385716

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	52,419,648 - 52,419,824 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	53,008,510 - 53,008,685	NCBI	Rnor6.0
Rnor_5.0	1	54,258,159 - 54,258,334	UniSTS	Rnor5.0
RGSC_v3.4	1	47,059,625 - 47,059,800	UniSTS	RGSC3.4
Celera	1	48,182,625 - 48,182,800	UniSTS
RH 3.4 Map	1	621.5	UniSTS
Cytogenetic Map	1	q11	UniSTS

RH125868

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	52,409,701 - 52,409,947 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	52,998,563 - 52,998,808	NCBI	Rnor6.0
Rnor_5.0	1	54,248,212 - 54,248,457	UniSTS	Rnor5.0
RGSC_v3.4	1	47,049,678 - 47,049,923	UniSTS	RGSC3.4
Celera	1	48,172,678 - 48,172,923	UniSTS
Cytogenetic Map	1	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC085346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000049831 ⟹ ENSRNOP00000042831

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	52,409,690 - 52,425,599 (-)	Ensembl
Rnor_6.0 Ensembl	1	52,998,529 - 53,014,466 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113562 ⟹ ENSRNOP00000083780

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	52,413,132 - 52,425,626 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114072 ⟹ ENSRNOP00000090145

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	52,409,690 - 52,425,746 (-)	Ensembl

RefSeq Acc Id:

NM_001008302 ⟹ NP_001008303

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,957,247 - 54,973,143 (-)	NCBI
mRatBN7.2	1	52,409,687 - 52,425,583 (-)	NCBI
Rnor_6.0	1	52,998,548 - 53,014,444 (-)	NCBI
Rnor_5.0	1	54,248,197 - 54,264,093 (-)	NCBI
RGSC_v3.4	1	47,049,663 - 47,065,559 (-)	RGD
Celera	1	48,172,663 - 48,188,559 (-)	RGD

Sequence:

show sequence

GGCTTCCGGGTGGGCGTGCGGGGCGGACGAACAAGTGGCCGGAGGCTCGGCCGTAGGACAGGGC
CATGGAGAAGCTACGGCGCGTCCTGAGCGGCCAAGACGACGAGGAGCAAGGCCTGACGGCACAG
GTCCTGGATGCCTCATCCCTGAGTTTCAACACCAGGTTGAAGTGGTTTGTCATATGCTTTGTTG
CTGGCATTTTCTTTTCAATCCTTGGAACTGGGTTGCTATGGCTTCCCAATGGCGTGAAGCTCTT
TGCAGTATTTTATACCCTTGGAAACCTTGCTGCATTGGCCAGTACGTGCTTTTTAATGGGACCT
GTGAAGCAACTGAAGAAAATGTTTGAAACAACAAGATTGCTTGCAACAATTATTATGCTGTTGT
GCCTGGTGTTTACCCTGTGTGCTGCTCTCTGGTGGCGGAAGAAGGGGCTGGCCTTACTCTTCTG
CATATTGCAGTTCTTGTCAATGACCTGGTATAGTCTGTCCTACATCCCGTATGCAAGGGACGCG
GTGCTCAAGTGCTGCTCCTCCATCCTGAGTTGAAGGTCGTCCCTGCCCAGGAGGAGTGACTGGG
AACTGATGCTGTGCCTGCTCCAGTGATCACTCCAGAGATGGCAGTAGTCTCAGCCGTGCCGTGG
ACCGCTGAACCTCACTGTGCAGCCCTCCGGTCCCTGCCCGTTAACCTCTGCTTCCAAAGACAAG
ATCGTAATCATTGCCACTTGTAAATACTTGTTACCCTGTTTTTAATCTTTACAGACAGCTTCTG
AAATGTGAATATTTAAGGTGTAAACCTGTGTTGTAAGATATATCCCACTTATTCAGCCTTTTTA
AATGCTCCACAACTTTAAAGAGTTTTTTAACTTTAAAAATGTGAAACTTTATATACTTTAAGCC
CAAAATTACTTATTACGTGTAATAAAAAGTAATATATGTATCTTGACAGTTTTGAAATAAACAC
TTGGAAATGTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008303	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85346	(Get FASTA)	NCBI Sequence Viewer
	EDL83113	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000042831.3
	ENSRNOP00000083780.1
	ENSRNOP00000090145.1
	ENSRNOP00055040944
	ENSRNOP00060013607
	ENSRNOP00065042533
GenBank Protein	Q5U3Y5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001008303 ⟸ NM_001008302
- UniProtKB:	Q5U3Y5 (UniProtKB/Swiss-Prot), A6KK24 (UniProtKB/TrEMBL), A0A8I6A0M9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFVICFVAGIFFSILGTGLLWLPNGVKLF AVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATIIMLLCLVFTLCAALWWRKKGLALLFC ILQFLSMTWYSLSYIPYARDAVLKCCSSILS hide sequence

Ensembl Acc Id:

ENSRNOP00000042831 ⟸ ENSRNOT00000049831

Ensembl Acc Id:

ENSRNOP00000090145 ⟸ ENSRNOT00000114072

Ensembl Acc Id:

ENSRNOP00000083780 ⟸ ENSRNOT00000113562

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5U3Y5-F1-model_v2	AlphaFold	Q5U3Y5	1-159	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689628

Promoter ID:

EPDNEW_R152

Type:

initiation region

Name:

Sft2d1_1

Description:

SFT2 domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	53,014,443 - 53,014,503	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359119	AgrOrtholog
BioCyc Gene	G2FUF-61512	BioCyc
Ensembl Genes	ENSRNOG00000024140	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055028725	UniProtKB/Swiss-Prot
	ENSRNOG00060010364	UniProtKB/Swiss-Prot
	ENSRNOG00065029904	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000049831.4	UniProtKB/TrEMBL
	ENSRNOT00000113562.1	UniProtKB/TrEMBL
	ENSRNOT00000114072.1	UniProtKB/TrEMBL
	ENSRNOT00055049745	UniProtKB/Swiss-Prot
	ENSRNOT00060017518	UniProtKB/Swiss-Prot
	ENSRNOT00065051666	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7304630	IMAGE-MGC_LOAD
InterPro	Vesicle_transpt_Got1/SFT2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Vesicle_transpt_SFT2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:292305	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105508	IMAGE-MGC_LOAD
NCBI Gene	292305	ENTREZGENE
PANTHER	PTHR23137	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VESICLE TRANSPORT PROTEIN SFT2A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Got1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sft2d1	PhenoGen
RatGTEx	ENSRNOG00000024140	RatGTEx
	ENSRNOG00055028725	RatGTEx
	ENSRNOG00060010364	RatGTEx
	ENSRNOG00065029904	RatGTEx
UniProt	A0A8I6A0M9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ADV3_RAT	UniProtKB/TrEMBL
	A0A8L2QLB3_RAT	UniProtKB/TrEMBL
	A6KK24	ENTREZGENE, UniProtKB/TrEMBL
	Q5U3Y5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Sft2d1	SFT2 domain containing 1	MGC105508	similar to chromosome 6 open reading frame 83; similar to RIKEN cDNA 5630401J11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message