Advanced Search (OLGA)

Gene: Or2t1 (olfactory receptor family 2 subfamily T member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or2t1

Name:

olfactory receptor family 2 subfamily T member 1

RGD ID:

1334361

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be active in plasma membrane. Orthologous to human OR2T1 (olfactory receptor family 2 subfamily T member 1); INTERACTS WITH bisphenol A; copper atom; copper(0).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1606; olfactory receptor gene Olr1606; olfactory receptor Olr1606; Olr1606; tpcr38

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	13,391,080 - 13,392,033 (-)	NCBI		GRCr8
mRatBN7.2	15	10,960,562 - 10,961,515 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	10,954,685 - 10,966,743 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	13,087,941 - 13,088,894 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	14,019,713 - 14,020,666 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	12,301,220 - 12,302,173 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	12,261,122 - 12,262,075 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	12,261,028 - 12,262,164 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	16,294,146 - 16,295,099 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	12,472,119 - 12,473,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	12,472,118 - 12,473,072 (-)	NCBI
Celera	15	10,968,306 - 10,969,259 (-)	NCBI		Celera
Cytogenetic Map	15	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or2t1	Rat	developmental and epileptic encephalopathy 54		ISO	RGD:1353113	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy, 54	ClinVar	PMID:25741868
Or2t1	Rat	gastrointestinal stromal tumor		ISO	RGD:1353113	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Or2t1	Rat	Neurodevelopmental Disorders		ISO	RGD:1353113	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Or2t1	Rat	parathyroid carcinoma		ISO	RGD:1353113	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Or2t1	Rat	prostate cancer		ISO	RGD:1353113	8554872	ClinVar Annotator: match by term: Malignant tumor of prostate	ClinVar	PMID:23265383

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or2t1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:1353113	6480464	bisphenol S results in decreased methylation of OR2T1 gene	CTD	PMID:31601247
Or2t1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1353113	6480464	Benzo(a)pyrene affects the methylation of OR2T1 exon; Benzo(a)pyrene affects the methylation of OR2T1 promoter	CTD	PMID:27901495
Or2t1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR2T1 mRNA	CTD	PMID:25181051
Or2t1	Rat	bisphenol F	decreases methylation	ISO	RGD:1353113	6480464	bisphenol F results in decreased methylation of OR2T1 gene	CTD	PMID:31601247
Or2t1	Rat	cadmium atom	multiple interactions	ISO	RGD:1353113	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of OR2T1 more ...	CTD	PMID:35301059
Or2t1	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1353113	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of OR2T1 more ...	CTD	PMID:35301059
Or2t1	Rat	CGP 52608	multiple interactions	ISO	RGD:1353113	6480464	CGP 52608 promotes the reaction [RORA protein binds to OR2T1 gene]	CTD	PMID:28238834
Or2t1	Rat	chlorpyrifos	decreases expression	ISO	RGD:1551939	6480464	Chlorpyrifos results in decreased expression of OR2T1 mRNA	CTD	PMID:32715474
Or2t1	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR2T1 mRNA	CTD	PMID:26033743
Or2t1	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR2T1 mRNA	CTD	PMID:26033743
Or2t1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of OR2T1 mRNA	CTD	PMID:25539665
Or2t1	Rat	tebuconazole	decreases expression	ISO	RGD:1353113	6480464	tebuconazole results in decreased expression of OR2T1 mRNA	CTD	PMID:30458266

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or2t1	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or2t1	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IBA	MGI:106182\|PANTHER:PTN002818000	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or2t1	Rat	G protein-coupled receptor signaling pathway		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or2t1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276\|InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or2t1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or2t1	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or2t1	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or2t1	Rat	membrane	located_in	IEA	InterPro:IPR000276\|InterPro:IPR000725\|InterPro:IPR017452	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or2t1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or2t1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Or2t1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or2t1	Rat	plasma membrane	is_active_in	IBA	MGI:106648\|PANTHER:PTN002818000\|UniProtKB:Q8N628\|UniProtKB:Q8NGE3\|UniProtKB:Q8NGS8\|UniProtKB:Q8NGS9\|UniProtKB:Q8NGT0\|UniProtKB:Q8NHC4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or2t1	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or2t1	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or2t1	Rat	olfactory receptor activity		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or2t1	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or2t1	Rat	olfactory receptor activity	enables	IBA	MGI:106182\|MGI:106648\|MGI:3030792\|MGI:3030794\|MGI:3030795\|PANTHER:PTN002818000\|UniProtKB:Q8NHC4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or2t1	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species.	Vanderhaeghen P, etal., Genomics 1997 Feb 1;39(3):239-46.

Or2t1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	13,391,080 - 13,392,033 (-)	NCBI		GRCr8
mRatBN7.2	15	10,960,562 - 10,961,515 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	10,954,685 - 10,966,743 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	13,087,941 - 13,088,894 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	14,019,713 - 14,020,666 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	12,301,220 - 12,302,173 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	12,261,122 - 12,262,075 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	12,261,028 - 12,262,164 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	16,294,146 - 16,295,099 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	12,472,119 - 12,473,072 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	12,472,118 - 12,473,072 (-)	NCBI
Celera	15	10,968,306 - 10,969,259 (-)	NCBI		Celera
Cytogenetic Map	15	p16	NCBI

OR2T1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	248,403,048 - 248,408,020 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	248,403,048 - 248,408,020 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	248,566,349 - 248,571,321 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	246,635,919 - 246,637,028 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	244,895,336 - 244,896,446	NCBI
Celera	1	221,855,733 - 221,856,842 (+)	NCBI		Celera
Cytogenetic Map	1	q44	NCBI
HuRef	1	218,956,300 - 218,957,409 (+)	NCBI		HuRef
CHM1_1	1	249,841,494 - 249,842,603 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	247,828,076 - 247,833,646 (+)	NCBI		T2T-CHM13v2.0

Or2t1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	8,140,697 - 8,141,650 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	8,137,972 - 8,146,935 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	14,328,113 - 14,329,066 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	14,322,828 - 14,331,791 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	15,160,627 - 15,161,580 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	13,121,380 - 13,122,333 (+)	NCBI		MGSCv36	mm8
Celera	14	10,004,247 - 10,005,200 (+)	NCBI		Celera
Cytogenetic Map	14	A1	NCBI
cM Map	14	7.08	NCBI

LOC102021128
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	30,198,087 - 30,199,043 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	30,198,087 - 30,199,058 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100972936
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	579,291 - 585,402 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	855,639 - 861,338 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	224,108,483 - 224,109,592 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	229,552,860 - 229,553,969 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	229,552,860 - 229,553,969 (+)	Ensembl	panpan1.1		panPan2

OR2T1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	2,613,861 - 2,614,946 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	2,613,990 - 2,614,946 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	2,264,145 - 2,265,101 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	2,346,746 - 2,347,702 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	2,346,746 - 2,347,702 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	2,510,348 - 2,511,304 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	2,310,991 - 2,311,947 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	2,251,859 - 2,252,815 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100623502
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	54,339,010 - 54,340,093 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	161,489,632 - 161,502,693 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OR2T1
(Chlorocebus sabaeus - green monkey)

No map positions available.

Variants in Or2t1
3 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	36
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000008798
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2266368	22711984	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1058250	14481294	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

endocrine system	endoderm	hemolymphoid system	mesenchyme	mesoderm	renal system	reproductive system	respiratory system
1	1	1	5	1	4	18	1


RefSeq Transcripts	NM_001000502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X89705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008798 ⟹ ENSRNOP00000008798

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	12,261,028 - 12,262,164 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097072 ⟹ ENSRNOP00000088504

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	10,954,685 - 10,966,743 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103426 ⟹ ENSRNOP00000094235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	10,954,694 - 10,966,743 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104048 ⟹ ENSRNOP00000094543

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	10,954,685 - 10,966,743 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117014 ⟹ ENSRNOP00000078522

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	10,954,685 - 10,966,743 (-)	Ensembl

RefSeq Acc Id:

NM_001000502 ⟹ NP_001000502

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	13,391,080 - 13,392,033 (-)	NCBI
mRatBN7.2	15	10,960,562 - 10,961,515 (-)	NCBI
Rnor_6.0	15	12,261,122 - 12,262,075 (-)	NCBI
Rnor_5.0	15	16,294,146 - 16,295,099 (-)	NCBI
RGSC_v3.4	15	12,472,119 - 12,473,072 (-)	RGD
Celera	15	10,968,306 - 10,969,259 (-)	RGD

Sequence:

show sequence

ATGGAGGGATACAACACATCATCTACTGACTTTACTTTCATGGGGCTGTTCAACAGAGAGGAAACCTCAGGTCTTGTATTTGCCACAATCTCTGTCATCTTCCTCACTGCACTAGTGGCCAATGGAAT
TATGATCTTTCTGATCCATACAGACACTCAACTCCATACCCCTATGTACTTCCTCCTCAGTCACTTGTCTTTCATTGACATGATGTACATCTCAACCATTGTGCCTAAGATGCTATTTGACTATCTTC
TAGGGCAGAGGACCATTTCCTTTGTGGGATGCACAGCTCAACACTTTCTCTACCTCACCCTTGTAGGAGCTGAGTTCTTTCTTCTGGGCCTCATGGCCTATGATCGCTATGTGGCCATCTGCAATCCA
CTCAGGTACCCTGTCCTCATGAGCCGCCGAATCTGTTGGATTATCATAGCAGGCTCCTGGTTTGGGGGATCTTTGGATGGCTTCCTTCTCACCCCAATCACCATGAGTTTTCCATTCTGTAGTTCAAG
AGAGATTAATCACTTCTTCTGTGAGGCACCTGCTGTGCTGAAGTTGGCATGCGCAGACACAGCCCTCTATGAGACAGTGATGTACGTGTGCTGTGTTCTGATGTTGTTGATTCCTTTCTCTGTAGTTA
TCTCCTCCTATGCCCGGATTCTGGCCACTGTCTACCACATGAGCTCTGTGGAAGGTAGGAAGAAAGCATTTGCTACCTGCTCCTCTCACATGACAGTGGTAACCTTGTTTTATGGGGCTGCCATATAC
ACCTATATGGTACCACACGCTTACCATTCCCCATCCCAAGACAAAATTTTTTCTGTGTTCTACACTATCCTCACACCCATGCTGAACCCCCTCATCTACAGCATGAGGAACAAGGATGTGTCTGGAGC
CCTGAGGAGGGCACTGGGGAAGATCAGGAGTTCTCAACGAGCGGCCAAACACTTCTGA

hide sequence


Protein RefSeqs	NP_001000502	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA61852	(Get FASTA)	NCBI Sequence Viewer
	EDL94114	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000078522.1
	ENSRNOP00000088504.1
	ENSRNOP00000094235.1
	ENSRNOP00000094543.1
	ENSRNOP00000109350

RefSeq Acc Id:

NP_001000502 ⟸ NM_001000502

- UniProtKB:

G3V6T8 (UniProtKB/TrEMBL), A6K067 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGYNTSSTDFTFMGLFNREETSGLVFATISVIFLTALVANGIMIFLIHTDTQLHTPMYFLLSHLSFIDMMYISTIVPKMLFDYLLGQRTISFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNP
LRYPVLMSRRICWIIIAGSWFGGSLDGFLLTPITMSFPFCSSREINHFFCEAPAVLKLACADTALYETVMYVCCVLMLLIPFSVVISSYARILATVYHMSSVEGRKKAFATCSSHMTVVTLFYGAAIY
TYMVPHAYHSPSQDKIFSVFYTILTPMLNPLIYSMRNKDVSGALRRALGKIRSSQRAAKHF

hide sequence

Ensembl Acc Id:

ENSRNOP00000008798 ⟸ ENSRNOT00000008798

Ensembl Acc Id:

ENSRNOP00000078522 ⟸ ENSRNOT00000117014

Ensembl Acc Id:

ENSRNOP00000094543 ⟸ ENSRNOT00000104048

Ensembl Acc Id:

ENSRNOP00000094235 ⟸ ENSRNOT00000103426

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V6T8-F1-model_v2	AlphaFold	G3V6T8	1-317	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-14384	BioCyc
Ensembl Genes	ENSRNOG00000006734	Ensembl
	ENSRNOG00000068637	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000085271	ENTREZGENE
Ensembl Transcript	ENSRNOT00000097072.1	UniProtKB/TrEMBL
	ENSRNOT00000103426.1	UniProtKB/TrEMBL
	ENSRNOT00000104048.1	UniProtKB/TrEMBL
	ENSRNOT00000117014.1	UniProtKB/TrEMBL
	ENSRNOT00000162950	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:305711	UniProtKB/TrEMBL
NCBI Gene	305711	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or2t1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006734	RatGTEx
	ENSRNOG00000068637	RatGTEx
	ENSRNOG00000085271	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6K067	ENTREZGENE, UniProtKB/TrEMBL
	G3V6T8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or2t1	olfactory receptor family 2 subfamily T member 1	Olr1606	olfactory receptor 1606	Symbol and Name Changed	1299863	APPROVED
2005-02-04	Olr1606	olfactory receptor 1606			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype