Symbol:
Tex10
Name:
testis expressed 10
RGD ID:
1312045
Description:
Predicted to be located in mitochondrion and nucleoplasm. Predicted to be part of MLL1 complex. Predicted to be active in nucleus. Orthologous to human TEX10 (testis expressed 10); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC298065; testis expressed gene 10; testis-expressed protein 10
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TEX10 (testis expressed 10) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Tex10 (testis expressed gene 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tex10 (testis expressed 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TEX10 (testis expressed 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TEX10 (testis expressed 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tex10 (testis expressed 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TEX10 (testis expressed 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TEX10 (testis expressed 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tex10 (testis expressed 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ISG20 (interferon stimulated exonuclease gene 20) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TEX10 (testis expressed 10)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tex10 (testis expressed gene 10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tex10 (testis expressed 10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG1575
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
IPI1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y48A6C.4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
tex10
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 67,557,770 - 67,603,904 (-) NCBI GRCr8 mRatBN7.2 5 62,762,230 - 62,808,373 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 62,762,230 - 62,808,373 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 64,739,864 - 64,786,013 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 66,559,162 - 66,605,312 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 66,528,626 - 66,574,780 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 64,179,247 - 64,225,844 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 64,179,247 - 64,225,844 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 68,695,431 - 68,742,028 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 65,118,575 - 65,165,336 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 65,124,068 - 65,160,400 (-) NCBI Celera 5 64,785,782 - 64,831,794 (+) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tex10 Rat 17beta-estradiol increases expression ISO TEX10 (Homo sapiens) 6480464 Estradiol results in increased expression of TEX10 mRNA CTD PMID:31614463 Tex10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tex10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TEX10 mRNA CTD PMID:19465110 Tex10 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TEX10 mRNA CTD PMID:33387578 Tex10 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tex10 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TEX10 mRNA CTD PMID:21570461 Tex10 Rat 2-palmitoylglycerol increases expression ISO TEX10 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TEX10 mRNA CTD PMID:37199045 Tex10 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of TEX10 mRNA CTD PMID:23358152 Tex10 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TEX10 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of TEX10 mRNA CTD PMID:28628672 Tex10 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TEX10 mRNA CTD PMID:36041667 Tex10 Rat aflatoxin B1 increases expression ISO TEX10 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of TEX10 mRNA CTD PMID:22100608 Tex10 Rat aflatoxin B1 decreases methylation ISO TEX10 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TEX10 gene CTD PMID:27153756 Tex10 Rat all-trans-retinoic acid decreases expression ISO TEX10 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TEX10 mRNA CTD PMID:33167477 Tex10 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of TEX10 mRNA CTD PMID:30047161 Tex10 Rat atrazine increases expression ISO TEX10 (Homo sapiens) 6480464 Atrazine results in increased expression of TEX10 mRNA CTD PMID:22378314 Tex10 Rat benzo[a]pyrene multiple interactions ISO Tex10 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of TEX10 mRNA] CTD PMID:22228805 Tex10 Rat benzo[a]pyrene increases expression ISO TEX10 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TEX10 mRNA CTD PMID:32234424 Tex10 Rat benzo[a]pyrene increases methylation ISO TEX10 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TEX10 promoter CTD PMID:27901495 Tex10 Rat benzo[a]pyrene increases expression ISO Tex10 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TEX10 mRNA CTD PMID:22228805 Tex10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TEX10 mRNA CTD PMID:25181051 Tex10 Rat bisphenol A decreases expression ISO TEX10 (Homo sapiens) 6480464 bisphenol A results in decreased expression of TEX10 protein CTD PMID:37567409 Tex10 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TEX10 mRNA CTD PMID:36041667 Tex10 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TEX10 mRNA CTD PMID:34947998 Tex10 Rat bisphenol A multiple interactions ISO TEX10 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of TEX10 mRNA CTD PMID:28628672 Tex10 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of TEX10 mRNA CTD PMID:36041667 Tex10 Rat cadmium dichloride decreases expression ISO TEX10 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TEX10 mRNA CTD PMID:38568856 Tex10 Rat caffeine decreases phosphorylation ISO TEX10 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of TEX10 protein CTD PMID:35688186 Tex10 Rat CGP 52608 multiple interactions ISO TEX10 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TEX10 gene] CTD PMID:28238834 Tex10 Rat chromium(6+) affects expression ISO Tex10 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of TEX10 mRNA CTD PMID:28472532 Tex10 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of TEX10 mRNA CTD PMID:24386269 Tex10 Rat cobalt dichloride increases expression ISO TEX10 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of TEX10 mRNA CTD PMID:19376846 Tex10 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of TEX10 mRNA CTD PMID:26033743 Tex10 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of TEX10 mRNA CTD PMID:26033743 Tex10 Rat copper(II) sulfate increases expression ISO TEX10 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of TEX10 mRNA CTD PMID:19549813 Tex10 Rat cyclosporin A increases expression ISO TEX10 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TEX10 mRNA CTD PMID:20106945 and PMID:25562108 Tex10 Rat dexamethasone multiple interactions ISO TEX10 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of TEX10 mRNA CTD PMID:28628672 Tex10 Rat enzyme inhibitor multiple interactions ISO TEX10 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TEX10 protein CTD PMID:23301498 Tex10 Rat epoxiconazole increases expression ISO Tex10 (Mus musculus) 6480464 epoxiconazole results in increased expression of TEX10 mRNA CTD PMID:35436446 Tex10 Rat FR900359 decreases phosphorylation ISO TEX10 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of TEX10 protein CTD PMID:37730182 Tex10 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TEX10 mRNA CTD PMID:22061828 and PMID:33387578 Tex10 Rat hydrogen peroxide affects expression ISO TEX10 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of TEX10 mRNA CTD PMID:20044591 Tex10 Rat indometacin multiple interactions ISO TEX10 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of TEX10 mRNA CTD PMID:28628672 Tex10 Rat ivermectin decreases expression ISO TEX10 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TEX10 protein CTD PMID:32959892 Tex10 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of TEX10 mRNA CTD PMID:23358152 Tex10 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of TEX10 mRNA CTD PMID:30047161 Tex10 Rat paracetamol affects expression ISO Tex10 (Mus musculus) 6480464 Acetaminophen affects the expression of TEX10 mRNA CTD PMID:17562736 Tex10 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tex10 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of TEX10 mRNA CTD PMID:36331819 Tex10 Rat pirinixic acid multiple interactions ISO TEX10 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of TEX10 mRNA CTD PMID:19710929 Tex10 Rat potassium chloride multiple interactions ISO TEX10 (Homo sapiens) 6480464 [Dronabinol results in decreased susceptibility to Potassium Chloride] which results in increased expression of TEX10 mRNA CTD PMID:29691375 Tex10 Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of TEX10 mRNA CTD PMID:30047161 Tex10 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of TEX10 mRNA CTD PMID:23358152 Tex10 Rat SB 431542 multiple interactions ISO TEX10 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of TEX10 protein CTD PMID:37664457 Tex10 Rat silicon dioxide increases expression ISO TEX10 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of TEX10 mRNA CTD PMID:25895662 Tex10 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of TEX10 mRNA CTD PMID:30047161 Tex10 Rat tert-butyl hydroperoxide increases expression ISO TEX10 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of TEX10 mRNA CTD PMID:15336504 Tex10 Rat tetrachloromethane increases expression ISO Tex10 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TEX10 mRNA CTD PMID:27339419 and PMID:31919559 Tex10 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TEX10 mRNA CTD PMID:31150632 Tex10 Rat thimerosal decreases expression ISO TEX10 (Homo sapiens) 6480464 Thimerosal results in decreased expression of TEX10 mRNA CTD PMID:27188386 Tex10 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TEX10 mRNA CTD PMID:23411599 and PMID:34492290 Tex10 Rat titanium dioxide decreases methylation ISO Tex10 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TEX10 promoter CTD PMID:35295148 Tex10 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of TEX10 gene CTD PMID:27618143 Tex10 Rat trimellitic anhydride decreases methylation ISO Tex10 (Mus musculus) 6480464 trimellitic anhydride results in decreased methylation of TEX10 promoter CTD PMID:24675093 Tex10 Rat triphenyl phosphate affects expression ISO TEX10 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TEX10 mRNA CTD PMID:37042841 Tex10 Rat triptonide affects expression ISO Tex10 (Mus musculus) 6480464 triptonide affects the expression of TEX10 mRNA CTD PMID:33045310 Tex10 Rat troglitazone decreases expression ISO Tex10 (Mus musculus) 6480464 troglitazone results in decreased expression of TEX10 mRNA CTD PMID:28973697 Tex10 Rat valproic acid affects expression ISO TEX10 (Homo sapiens) 6480464 Valproic Acid affects the expression of TEX10 mRNA CTD PMID:25979313 Tex10 Rat vorinostat decreases expression ISO TEX10 (Homo sapiens) 6480464 vorinostat results in decreased expression of TEX10 mRNA CTD PMID:27188386
Tex10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 67,557,770 - 67,603,904 (-) NCBI GRCr8 mRatBN7.2 5 62,762,230 - 62,808,373 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 62,762,230 - 62,808,373 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 64,739,864 - 64,786,013 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 66,559,162 - 66,605,312 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 66,528,626 - 66,574,780 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 64,179,247 - 64,225,844 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 64,179,247 - 64,225,844 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 68,695,431 - 68,742,028 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 65,118,575 - 65,165,336 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 65,124,068 - 65,160,400 (-) NCBI Celera 5 64,785,782 - 64,831,794 (+) NCBI Celera Cytogenetic Map 5 q22 NCBI
TEX10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 100,302,084 - 100,352,942 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 100,302,077 - 100,352,942 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 103,064,366 - 103,115,224 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 102,104,190 - 102,154,995 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 100,143,923 - 100,194,729 NCBI Celera 9 73,577,686 - 73,628,526 (-) NCBI Celera Cytogenetic Map 9 q31.1 NCBI HuRef 9 72,663,398 - 72,714,298 (-) NCBI HuRef CHM1_1 9 103,210,798 - 103,261,707 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 112,473,720 - 112,524,578 (-) NCBI T2T-CHM13v2.0
Tex10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 48,430,805 - 48,473,492 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 48,430,858 - 48,473,459 (-) Ensembl GRCm39 Ensembl GRCm38 4 48,430,858 - 48,473,464 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 48,430,858 - 48,473,459 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 48,443,828 - 48,486,294 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 48,443,828 - 48,486,294 (-) NCBI MGSCv36 mm8 Celera 4 48,454,349 - 48,496,904 (-) NCBI Celera Cytogenetic Map 4 B1 NCBI cM Map 4 26.13 NCBI
Tex10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 25,381,751 - 25,447,985 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 25,382,222 - 25,445,492 (+) NCBI ChiLan1.0 ChiLan1.0
TEX10 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 39,100,927 - 39,151,881 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 39,103,298 - 39,154,252 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 71,394,926 - 71,445,750 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 99,509,642 - 99,560,447 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 99,509,648 - 99,560,447 (-) Ensembl panpan1.1 panPan2
TEX10 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 57,196,683 - 57,255,847 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 57,196,683 - 57,255,849 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 55,640,283 - 55,704,098 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 58,317,999 - 58,381,832 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 58,318,006 - 58,381,825 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 56,821,883 - 56,885,904 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 56,846,847 - 56,910,846 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 57,546,505 - 57,610,510 (-) NCBI UU_Cfam_GSD_1.0
Tex10 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 172,065,343 - 172,108,948 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 8,611,075 - 8,656,545 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 8,612,919 - 8,656,545 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TEX10 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 242,058,041 - 242,120,554 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 242,058,035 - 242,120,547 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 270,407,894 - 270,480,569 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TEX10 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 39,087,506 - 39,138,134 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 39,091,085 - 39,138,027 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666035 3,417,617 - 3,468,710 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tex10
.
Predicted Target Of
Count of predictions: 289 Count of miRNA genes: 191 Interacting mature miRNAs: 213 Transcripts: ENSRNOT00000011401 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
RH131507
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 62,762,498 - 62,762,687 (+) MAPPER mRatBN7.2 Rnor_6.0 5 64,179,516 - 64,179,704 NCBI Rnor6.0 Rnor_5.0 5 68,695,700 - 68,695,888 UniSTS Rnor5.0 RGSC_v3.4 5 65,118,844 - 65,119,032 UniSTS RGSC3.4 Celera 5 64,831,337 - 64,831,525 UniSTS RH 3.4 Map 5 413.6 UniSTS Cytogenetic Map 5 q22 UniSTS
AW530466
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 62,763,574 - 62,763,790 (+) MAPPER mRatBN7.2 Rnor_6.0 5 64,180,592 - 64,180,807 NCBI Rnor6.0 Rnor_5.0 5 68,696,776 - 68,696,991 UniSTS Rnor5.0 RGSC_v3.4 5 65,119,920 - 65,120,135 UniSTS RGSC3.4 Celera 5 64,830,234 - 64,830,449 UniSTS RH 3.4 Map 5 414.5 UniSTS Cytogenetic Map 5 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011401 ⟹ ENSRNOP00000011401
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 62,762,230 - 62,808,373 (-) Ensembl Rnor_6.0 Ensembl 5 64,179,247 - 64,225,844 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106377 ⟹ ENSRNOP00000090246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 62,762,230 - 62,808,373 (-) Ensembl
RefSeq Acc Id:
NM_001106653 ⟹ NP_001100123
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 67,557,770 - 67,603,904 (-) NCBI mRatBN7.2 5 62,762,230 - 62,808,373 (-) NCBI Rnor_6.0 5 64,179,247 - 64,225,844 (-) NCBI Rnor_5.0 5 68,695,431 - 68,742,028 (-) NCBI RGSC_v3.4 5 65,118,575 - 65,165,336 (-) RGD Celera 5 64,785,782 - 64,831,794 (+) RGD
Sequence:
ATGCTGTAAAAATATGTGTTACCTGAACTGTCTAAACTGCCCTCAGATGTGACTCAAGGCACTCCCAACAGACACCTGCCATCGTCACCCGGAGCTCATGGCTCCTGGTCTAAAGAACTGTGGTCCTT
hide sequence
RefSeq Acc Id:
XM_006238034 ⟹ XP_006238096
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 67,558,222 - 67,595,685 (-) NCBI mRatBN7.2 5 62,762,682 - 62,800,171 (-) NCBI Rnor_6.0 5 64,179,699 - 64,218,926 (-) NCBI Rnor_5.0 5 68,695,431 - 68,742,028 (-) NCBI
Sequence:
TGTCCTGTCCGGCCCTTCTGAGGCGCGGACACGCGAGGCCCAGGTGGCGGGACGTGCTGAGGCG
hide sequence
RefSeq Acc Id:
XM_039109450 ⟹ XP_038965378
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 67,558,222 - 67,596,951 (-) NCBI mRatBN7.2 5 62,762,682 - 62,801,337 (-) NCBI
RefSeq Acc Id:
NP_001100123 ⟸ NM_001106653
- UniProtKB:
D4A401 (UniProtKB/TrEMBL), A6KJF4 (UniProtKB/TrEMBL), A0A8I6AC27 (UniProtKB/TrEMBL)
- Sequence:
MTKKRKRQDDFQKVKLKVGKKKPKLENATATNFKTKAIHLPEQLKEDRTLPTNNRKLNIKDLLSQMHHYNGGVKQSALLGLKDLLSQYPCIIDAHLSNILSEVTAVFTDRDANVRLAAVQLLQFLAPK
hide sequence
RefSeq Acc Id:
XP_006238096 ⟸ XM_006238034
- Peptide Label:
isoform X1
- UniProtKB:
D4A401 (UniProtKB/TrEMBL), A6KJF4 (UniProtKB/TrEMBL), A0A8I6AC27 (UniProtKB/TrEMBL)
- Sequence:
MTKKRKRQDDFQKVKLKVGKKKPKLENATATNFKTKAIHLPEQLKEDRTLPTNNRKLNIKDLLS
hide sequence
Ensembl Acc Id:
ENSRNOP00000011401 ⟸ ENSRNOT00000011401
RefSeq Acc Id:
XP_038965378 ⟸ XM_039109450
- Peptide Label:
isoform X1
- UniProtKB:
D4A401 (UniProtKB/TrEMBL), A6KJF4 (UniProtKB/TrEMBL), A0A8I6AC27 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090246 ⟸ ENSRNOT00000106377
RGD ID: 13693725 Promoter ID: EPDNEW_R4249 Type: initiation region Name: Tex10_1 Description: testis expressed 10 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 64,219,115 - 64,219,175 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2010-05-25
Tex10
testis expressed 10
Tex10
testis expressed gene 10
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Tex10
testis expressed gene 10
Tex10_predicted
testis expressed gene 10 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Tex10_predicted
testis expressed gene 10 (predicted)
Symbol and Name status set to approved
70820 APPROVED
